[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00332"

            ""
            ""

OrgPattern ------5556665654-2-----------------------------1-------------774---- 2--2---1----11-----------1------------24------1--11-1-1-1---------2-----111-----1---1--1-----------------------------------------------------------11------11----1----------------------1------2-1--------1----------1-----------------------------------11-------------1111-----------------------------------------------------------------------------------------1-1-----1---------------------1-----1----11111111111------2-2-------------------------------1-1111111-----------------------------------------------1111211----11321-----413-111--1-1------------2-----------------------------------------------------------------------------22------------------1----1-11-1--------------1---1--1111111111-11111111111111111111-1----1111111111111111121--111-1-----------------22222-------1----------------2212221-------1--11-------111--1----1----------------------------------------------------------------------------------------- ----11------223547444437576441222333322222222296676999117442255232-215123242222215555432-6D5433A3333324635-221---11--------------------------------------2---1-----------------441--1--357DDK5B7346767- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MATLTAGGNSAFKNFHNQFAHIQDPNERRRLALAEIDKAPFGWYHIRAIVVAGIGFFTDA:Sequence : :Sec Str : ===========================:RP:SCP|34->198|1pw4A|5e-12|11.8|153/434|f.38.1.1 : =========================================================:BL:SWS|4->538|PHO84_YEAST|e-178|59.2|527/587 : $$$$$$$$$$$:RP:PFM|50->538|PF00083|6e-37|32.3|424/433|Sugar_tr 61: . . . * . .: 120 :YDIFAINLASAMLGVVFWLDAKDKPGKIPSSADTAIKVATSGGTVIGQVGFGWLADVVGR:Sequence : TTcccccT:Sec Str :============================================================:RP:SCP|34->198|1pw4A|5e-12|11.8|153/434|f.38.1.1 :============================================================:BL:SWS|4->538|PHO84_YEAST|e-178|59.2|527/587 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->538|PF00083|6e-37|32.3|424/433|Sugar_tr 121: . . + . . .: 180 :KKMYGLELMVIIFATLAQALSSDSPGVSIVGLLIFWRVIMGIGIGGDYPLSSIITSEFAT:Sequence :TccccccHHHHHHHHHHHHHcccHHHH TTccEETTEEccccccccccGGGcccc:Sec Str : ######################:PROS|159->184|PS00217|SUGAR_TRANSPORT_2|PDOC00190| :============================================================:RP:SCP|34->198|1pw4A|5e-12|11.8|153/434|f.38.1.1 :============================================================:BL:SWS|4->538|PHO84_YEAST|e-178|59.2|527/587 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->538|PF00083|6e-37|32.3|424/433|Sugar_tr 181: . * . . . .: 240 :TKWRGAMMGAVFAMQGIGQFAAALVALIVAAGFKESLKTAESESQCSGVCQVAVDKMWRV:Sequence :EEEEccccTTccHHHHHHHHc ccEEEEEEEEccTTcTT:Sec Str : XXXXXXXXXXX :SEG|201->211|aaalvalivaa :#### :PROS|159->184|PS00217|SUGAR_TRANSPORT_2|PDOC00190| :================== :RP:SCP|34->198|1pw4A|5e-12|11.8|153/434|f.38.1.1 :============================================================:BL:SWS|4->538|PHO84_YEAST|e-178|59.2|527/587 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->538|PF00083|6e-37|32.3|424/433|Sugar_tr 241: + . . . . *: 300 :VIGFGAVPGCIALYYRLTIPETPRYTFDVQRDVVKGAEDTKAYMLGKPEGSPDELQRIAT:Sequence :cccHHHHHHHHHHHHHHHHcccccccHHHHH HTHHHHHHHHHHTTcTTcEEccTTcccc:Sec Str :============================================================:BL:SWS|4->538|PHO84_YEAST|e-178|59.2|527/587 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->538|PF00083|6e-37|32.3|424/433|Sugar_tr 301: . . . . + .: 360 :LEQSQSQLQVPKASWSDFWTHYKQWKHGKVLLGTAGSWFFLDVAFYGLGLNNSIILSAIG:Sequence :EEHHHHHHHH :Sec Str :============================================================:BL:SWS|4->538|PHO84_YEAST|e-178|59.2|527/587 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->538|PF00083|6e-37|32.3|424/433|Sugar_tr 361: . . . * . .: 420 :YTGGKDMYEIMYNTAVGNLILICAGAIPGYWVTVATVDTLGRKPIQIMGFTMLTVLFIVI:Sequence : :Sec Str :============================================================:BL:SWS|4->538|PHO84_YEAST|e-178|59.2|527/587 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->538|PF00083|6e-37|32.3|424/433|Sugar_tr 421: . . + . . .: 480 :GFAYDKLLHSNNGLLALYVIAQFFFNFGPNSTTFIVPGECFPTRYRSTSHGLSAASGKVG:Sequence : :Sec Str :============================================================:BL:SWS|4->538|PHO84_YEAST|e-178|59.2|527/587 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|50->538|PF00083|6e-37|32.3|424/433|Sugar_tr 481: . * . . . .: 540 :AIIAQCVFGPLVSRGAKPGSSEKPWLKHVMQIFALFMLCGLITSFLIPETKRKTLEELAG:Sequence : :Sec Str :========================================================== :BL:SWS|4->538|PHO84_YEAST|e-178|59.2|527/587 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|50->538|PF00083|6e-37|32.3|424/433|Sugar_tr 541: + . . . . *: 600 :EVPETPNYDPVTAGHARREGQQVKGGEETPETVSPDMQPNEKHTTIV :Sequence : :Sec Str