[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00337"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--11--1------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 11--112-411-1111111-1111111111111111111111111111112222-111111111111111111111111111111111-11111112111111222-1213533347443343488484Cc8-94A32246254324443324745634112242215111342111118111113224122112322- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSSSQRSAADLDTSRTKPHRPFQEDHAAVQRLEEAISHPGSVKINVKGAFIVDEQPTEQS:Sequence : :Sec Str : ================================:BL:SWS|29->422|PANK_SCHPO|6e-92|56.2|356/403 61: . . . * . .: 120 :RVVFDCRDGIHYEHKDIRLPHHTDVVSHVAVDIGGSLAKLVYFSPELGSSADGGRLNFLN:Sequence : EEEcccEEEEEEEEEEEEETTEEEEEEEEE:Sec Str : ================================:RP:SCP|89->176|2aa4A1|2e-04|17.1|82/119|c.55.1.10 :============================================================:BL:SWS|29->422|PANK_SCHPO|6e-92|56.2|356/403 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->421|PF03630|e-104|65.0|300/305|Fumble 121: . . + . . .: 180 :FETERIDLCIDFLKQLKENHRKLNGSAPGPLCIMATGGGAYKYYDRLKEELGVDIIREDE:Sequence :EEGGGHHHHHHHHHHEEccEETTcGGGccEEEGHEccTTHHHHHHHHHTTcccEEEEccH:Sec Str :======================================================== :RP:SCP|89->176|2aa4A1|2e-04|17.1|82/119|c.55.1.10 :============================================================:BL:SWS|29->422|PANK_SCHPO|6e-92|56.2|356/403 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->421|PF03630|e-104|65.0|300/305|Fumble 181: . * . . . .: 240 :MECLIIGLDFFITEIPNEVFTYSETSPMEFAEARPDVYPYLLVNIGSGVSMVKVSAPRRF:Sequence :HHHHHHHHHHHHHHccccEEEEETTTcTTTcEEEEccccEEEEEEcccEEEEEEEETTEE:Sec Str : =============================================:RP:SCP|196->421|2i7nA2|2e-34|41.2|204/212|c.55.1.14 :============================================================:BL:SWS|29->422|PANK_SCHPO|6e-92|56.2|356/403 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->421|PF03630|e-104|65.0|300/305|Fumble 241: + . . . . *: 300 :ERVGGTSLGGGTFWGLMSLLTGARTFDEMLAMAELGDNSGVDMLVGDIYGTDYTKIGLKS:Sequence :EEEEEEcccHHHHHHHHHHHTccccHHHHHHHHHHccGGGTcEEHHHHHccccGGGTccT:Sec Str : XXXXXXXXXXXXX :SEG|244->256|ggtslgggtfwgl :============================================================:RP:SCP|196->421|2i7nA2|2e-34|41.2|204/212|c.55.1.14 :============================================================:BL:SWS|29->422|PANK_SCHPO|6e-92|56.2|356/403 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->421|PF03630|e-104|65.0|300/305|Fumble 301: . . . . + .: 360 :STIASTFGKVFKMQRLAERSAQGSECLCESDSESERDVSQFRREDISRSLLFAISNNIGQ:Sequence :TcEEETTGGGGcHHHHHHcc HT TccHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXX :SEG|324->335|seclcesdsese :============================================================:RP:SCP|196->421|2i7nA2|2e-34|41.2|204/212|c.55.1.14 :============================================================:BL:SWS|29->422|PANK_SCHPO|6e-92|56.2|356/403 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->421|PF03630|e-104|65.0|300/305|Fumble 361: . . . * . .: 420 :IAYLQSEKHQIKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAF:Sequence :HHHHHHHHHTcccEEEEcGGGcccHHHHHHHHHHHHHHTTTcccEEEETTGGGHHHHHHH:Sec Str :============================================================:RP:SCP|196->421|2i7nA2|2e-34|41.2|204/212|c.55.1.14 :============================================================:BL:SWS|29->422|PANK_SCHPO|6e-92|56.2|356/403 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|89->421|PF03630|e-104|65.0|300/305|Fumble 421: . . + . . .: 480 :LKRQPQDWGRRRSIENTAATRFAAYREELRSATKNGTELPPT :Sequence :HH :Sec Str := :RP:SCP|196->421|2i7nA2|2e-34|41.2|204/212|c.55.1.14 :== :BL:SWS|29->422|PANK_SCHPO|6e-92|56.2|356/403 :$ :RP:PFM|89->421|PF03630|e-104|65.0|300/305|Fumble