[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00341"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----11--11--111111--1111111111111111111111111111111111-11111111111-------1-------1111-11--111-1------11121----2-----11--111-21-1-332-11111111-131--1---111--111---111---11---1------------112-1---1111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASSPPPPNTTSRPQSLGTPAAPVPPPVPVETHPNRAGLKPRPPLRPPPDPSRLAPEDAY:Sequence : XXXXXXXXXXXXXX :SEG|3->16|ssppppnttsrpqs : XXXXXXXXXXX :SEG|20->30|paapvpppvpv : XXXXXXXXXXXXXXXXXX :SEG|39->56|lkprpplrpppdpsrlap 61: . . . * . .: 120 :FAHSPPRLRPLNLPNNHAASNPDLLNRVVATPAAVAALRPPPAVPGTKPKATGEARRDRG:Sequence : XXXXXXXXXXXX :SEG|65->76|pprlrplnlpnn : XXXXXXXXXXXXXXXXXX :SEG|88->105|vvatpaavaalrpppavp : XXXXX:SEG|116->127|rrdrgrsrrrkr 121: . . + . . .: 180 :RSRRRKRQWKKLLWVKQSYPDNYTDTETFLDHLQRNPRLRPYDFWPLVADFTVIVQHSSV:Sequence :XXXXXXX :SEG|116->127|rrdrgrsrrrkr : ====================================================:BL:SWS|129->455|GPI2_SCHPO|1e-29|31.1|280/324 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|129->449|PF06432|2e-74|63.5|263/278|GPI2 181: . * . . . .: 240 :GGQLGDPMYDILLVSLGLLGGKGSDGIRAIAAWYGSAIQQTTAQAPALCPVPQETTDKKS:Sequence : XXXXXXXXXXXXXXX :SEG|192->206|llvslgllggkgsdg :============================================================:BL:SWS|129->455|GPI2_SCHPO|1e-29|31.1|280/324 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|129->449|PF06432|2e-74|63.5|263/278|GPI2 241: + . . . . *: 300 :LRTWAWAISRFIQYRSLPRRQTKSALLIFCALQGLSPILKSLTKSTTSDSIWAMSCWLMI:Sequence : XXXXXXXXXX :SEG|279->288|lksltkstts :============================================================:BL:SWS|129->455|GPI2_SCHPO|1e-29|31.1|280/324 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|129->449|PF06432|2e-74|63.5|263/278|GPI2 301: . . . . + .: 360 :INVFFFDYGSGTKENQNLSNNAGAGAVAAKFPASLSTNAALMASTVLASRLKSTTHVFSL:Sequence : XXXXXXXXXX :SEG|320->329|nnagagavaa :============================================================:BL:SWS|129->455|GPI2_SCHPO|1e-29|31.1|280/324 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|129->449|PF06432|2e-74|63.5|263/278|GPI2 361: . . . * . .: 420 :TLFSIEVFGLFPVFRRHLRAISWRGHVLLTVSLVIAAGAAVGVTLKGGYKGMILGILIGA:Sequence :============================================================:BL:SWS|129->455|GPI2_SCHPO|1e-29|31.1|280/324 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|129->449|PF06432|2e-74|63.5|263/278|GPI2 421: . . + . . .: 480 :PSTALAMGGCSWWLIRLQKYKNVVAGPWDQAKPILRRHWD :Sequence :=================================== :BL:SWS|129->455|GPI2_SCHPO|1e-29|31.1|280/324 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|129->449|PF06432|2e-74|63.5|263/278|GPI2