[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00357"

            ""
            ""

OrgPattern --------1111111-----------------1-21--------1-1---111--------------- 1-1141132222213-111-13--4211111133332233-1--1-211---1112-1--1-31--11211----1------1--111111--1---------1-1-2-------------------------------11---21-----------------------1---------------------2-12222234313223331---1-322-----1111111122-111111111111111--1--211111-2122211112----1--------------------------------------------------1----------1----------------1-221-----------1-----111------11-222-122113----------1---1--1111-1-3---22-221---1--1-------1--33333333-1121------1------------------------1--21--1---32122211------1112-1-21222132--11-111--21--1--1-------------------11------------1--------2---1-1-------------------------11-------1--1--------1211----11--11-------------111111--111-111---1--1111-1-111------1113433-23232232223222332--1------222222222222----------------------11------11122113-1-----11111211-2131-1122----1----111-11121--1-----1-11------------------------------------------------------------------ --------------1ZfgQuori****JJHJDIQMGIHHHCEHCDCcPUkl***JQSNKFIIRCO66C6F87S8JAA4ABDHFIQFAF-TWDf8PCFBG98-DF97----------------------------------------------------------------------1----------5-f--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAQDIPSDTIEISHSRSNENTASNDGETSEHRESSAPRKVTWKKFLGVEKDGPDLEAVLD:Sequence : :Sec Str 61: . . . * . .: 120 :DDNNYGPRDRWTMGILSDKQTEEVPGTILLLTSSRNEPLGLRQQPARVSASSLPSPYPPS:Sequence : :Sec Str : XXXXXXXXXXXX:SEG|109->129|sasslpspyppsrsssrnpap 121: . . + . . .: 180 :RSSSRNPAPQQKRTPDGKIVLDPQPEESLNDPLNWPQWRRDLALLSLGFYCMIGGGMTPI:Sequence : H:Sec Str :XXXXXXXXX :SEG|109->129|sasslpspyppsrsssrnpap : ======================================:RP:SCP|143->342|1pw4A|1e-22|11.0|200/434|f.38.1.1 : =============================================:BL:SWS|136->309,535->754|YHMA_SCHPO|4e-23|29.8|392/581 : $$$$$$$$$$$$$$$$$:RP:PFM|164->339,569->692|PF07690|5e-21|31.6|282/347|MFS_1 181: . * . . . .: 240 :LAAAFNDVSEEYNVSFQKVALTTGLYMLGLGIGSVVMSPTAILFGKRPVYIAGATMFIIS:Sequence :HHHHHHHHHTTcccTTHHHHHHHHHHHHHHHHHHTTHHHHHTTcccccccHHHHHHHH :Sec Str :============================================================:RP:SCP|143->342|1pw4A|1e-22|11.0|200/434|f.38.1.1 :============================================================:BL:SWS|136->309,535->754|YHMA_SCHPO|4e-23|29.8|392/581 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|164->339,569->692|PF07690|5e-21|31.6|282/347|MFS_1 241: + . . . . *: 300 :AVWCALSPTYVSLVIARIFQGIAVSPVECLPSATIAEIFFLHERAYRVGIYTLLLLGGKN:Sequence : :Sec Str : XXXXXX :SEG|293->298|llllgg :============================================================:RP:SCP|143->342|1pw4A|1e-22|11.0|200/434|f.38.1.1 :============================================================:BL:SWS|136->309,535->754|YHMA_SCHPO|4e-23|29.8|392/581 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|164->339,569->692|PF07690|5e-21|31.6|282/347|MFS_1 301: . . . . + .: 360 :LIPLVSAAITEGLGWRWIFWVVAITIAFGLVLVFFFVPETFWDRTPRPRTKRPKARRSVS:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|344->357|rtprprtkrpkarr :========================================== :RP:SCP|143->342|1pw4A|1e-22|11.0|200/434|f.38.1.1 :========= :BL:SWS|136->309,535->754|YHMA_SCHPO|4e-23|29.8|392/581 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|164->339,569->692|PF07690|5e-21|31.6|282/347|MFS_1 361: . . . * . .: 420 :DIVAHSFRGRSPEPVTPTEIRQKARDASTQKKQKDLRVDFADDVKSDMRRSGEHPRDSDN:Sequence : :Sec Str 421: . . + . . .: 480 :QVLDEKHVEGEPAGDTVAEGYFSVPPASALTPPSTEEDSTTRKDVLDLESARSQPVSRDI:Sequence : :Sec Str 481: . * . . . .: 540 :SVDASADPLHASLQQIYTSNLRSKPPVSFSQSLKPWNGRIARDNWFRVMTRPFILFAYPA:Sequence : :Sec Str : ======:BL:SWS|136->309,535->754|YHMA_SCHPO|4e-23|29.8|392/581 541: + . . . . *: 600 :VLWSSMVYALSVGWLIVLSEAVAEIYRNKESYNFSALATGLVYISPFVGGILGTVVAGKV:Sequence : :Sec Str : ============================:RP:SCP|573->731|1pv6A|2e-04|12.6|145/417|f.38.1.2 :============================================================:BL:SWS|136->309,535->754|YHMA_SCHPO|4e-23|29.8|392/581 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|164->339,569->692|PF07690|5e-21|31.6|282/347|MFS_1 601: . . . . + .: 660 :SDIIVRWMARRNGGIYEPEFRLVMSAPIAICTAMGLMGFGWSAQEKEKWIVPTVFFGILS:Sequence : :Sec Str :============================================================:RP:SCP|573->731|1pv6A|2e-04|12.6|145/417|f.38.1.2 :============================================================:BL:SWS|136->309,535->754|YHMA_SCHPO|4e-23|29.8|392/581 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|164->339,569->692|PF07690|5e-21|31.6|282/347|MFS_1 661: . . . * . .: 720 :FGCTLGSTTSITFCVDSYRQYAGEALVTLNFSKNVLHGFVFSLFFVDWLHSDGAKTVFVA:Sequence : :Sec Str :============================================================:RP:SCP|573->731|1pv6A|2e-04|12.6|145/417|f.38.1.2 :============================================================:BL:SWS|136->309,535->754|YHMA_SCHPO|4e-23|29.8|392/581 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|164->339,569->692|PF07690|5e-21|31.6|282/347|MFS_1 721: . . + . . .: 780 :LGGIHLACMLFSIPMYIYGKRARMWTVRKRLMEKF :Sequence : :Sec Str :=========== :RP:SCP|573->731|1pv6A|2e-04|12.6|145/417|f.38.1.2 :================================== :BL:SWS|136->309,535->754|YHMA_SCHPO|4e-23|29.8|392/581