[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00379"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----AB7-134-9CC47777876788588477866789797797776667859566488865968868787886ABABAC7AA99A54-9E67867566779AFEC-A6AHRLIGGB72446D8LD5J6T*J1IAK5866J78J959586D44I5DBAA88C66484I8AF56BB7453O46653VDPP7HI7679A7- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSFPAPSPDLSRGASRLKDGSEPRQSVMIQSGETDDVEVAPALETKSKPAVKPWAHFFAG:Sequence : cccccTTHHHHHHH:Sec Str : ===========:RP:SCP|50->382|1okcA|4e-53|22.2|288/292|f.42.1.1 : ===============================:BL:SWS|30->387|YKQ9_SCHPO|4e-81|52.5|337/361 : $$$$$$$$:RP:PFM|53->165|PF00153|4e-13|36.3|90/97|Mito_carr 61: . . . * . .: 120 :AVGGMTAATLTSPLDVLKTRLQSDFYQAQLRSLRAAHPLPQSHSILSLSRSAMVHFSETV:Sequence :HHHHHHHHHHHHHHHHHHHHHHHGGGccc ccTTTccccHH:Sec Str :============================================================:RP:SCP|50->382|1okcA|4e-53|22.2|288/292|f.42.1.1 :============================================================:BL:SWS|30->387|YKQ9_SCHPO|4e-81|52.5|337/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|53->165|PF00153|4e-13|36.3|90/97|Mito_carr 121: . . + . . .: 180 :QILRSIHVHEGWRALFKGLGPNLTGVVPARAINFYVYGNGKRILNDYFGYIPTETPASIH:Sequence :HHHHHHHHHHcGGGGGTTHHHHHHHHHHHHHHHHHHHHHHHHHHTTTccTTTcHHHHHHH:Sec Str :============================================================:RP:SCP|50->382|1okcA|4e-53|22.2|288/292|f.42.1.1 :============================================================:BL:SWS|30->387|YKQ9_SCHPO|4e-81|52.5|337/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|53->165|PF00153|4e-13|36.3|90/97|Mito_carr 181: . * . . . .: 240 :LAAAAVAGIATGTATNPIWLVKTRLQLDKSNASNIPGRGRQYKNSLDCIRQTVRHEGIRG:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHTc GGccccTTccccccHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|182->195|aaaavagiatgtat :============================================================:RP:SCP|50->382|1okcA|4e-53|22.2|288/292|f.42.1.1 :============================================================:BL:SWS|30->387|YKQ9_SCHPO|4e-81|52.5|337/361 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|197->269|PF00153|9e-12|47.3|68/97|Mito_carr 241: + . . . . *: 300 :LYRGLTASYLGVTESSLQWVMYEEMKRILARRAARRAADPAHVRGWTDTAEHWVGTITAA:Sequence :HTTTHHHHHHHHHHHHHHHHHHHHHHHHccTTccT cccccccHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXX :SEG|270->278|arraarraa : XX:SEG|299->310|aagsakllaaaa :============================================================:RP:SCP|50->382|1okcA|4e-53|22.2|288/292|f.42.1.1 :============================================================:BL:SWS|30->387|YKQ9_SCHPO|4e-81|52.5|337/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|197->269|PF00153|9e-12|47.3|68/97|Mito_carr 301: . . . . + .: 360 :GSAKLLAAAATYPHEVVRTRLRQAPTIPAGGGKVQMKYTGLMQCFRVIWKEEGMAGLYGG:Sequence :HHHHHHHHHHTHHHHHHHHHHHTTTTcccTTccTTcccccHHHHHHHHHHHTcccGGGTT:Sec Str :XXXXXXXXXX :SEG|299->310|aagsakllaaaa :============================================================:RP:SCP|50->382|1okcA|4e-53|22.2|288/292|f.42.1.1 :============================================================:BL:SWS|30->387|YKQ9_SCHPO|4e-81|52.5|337/361 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|311->385|PF00153|3e-16|54.3|70/97|Mito_carr 361: . . . * . .: 420 :LTPHLLRVVPSAAIMFGMYEMILRLCGTTS :Sequence :TTHHHHHHHHHHHHHHHHHccc :Sec Str :====================== :RP:SCP|50->382|1okcA|4e-53|22.2|288/292|f.42.1.1 :=========================== :BL:SWS|30->387|YKQ9_SCHPO|4e-81|52.5|337/361 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|311->385|PF00153|3e-16|54.3|70/97|Mito_carr