[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00384"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------12111-11111111111111111121111111111111111111111111--------------------------1211111----1-1-11--------------------------------------------------------------------------------11-12-------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MATEDDNFDIDIYGDAGGYNGNENEGDYKVEEPELILDAPETSHQNGIGDGGASGGNNNA:Sequence : :Sec Str : XXXXXXXXXXXXXXXX :SEG|13->28|ygdaggyngnenegdy : XXXXXXXXXXXXXXX:SEG|46->65|ngigdggasggnnnatengn 61: . . . * . .: 120 :TENGNHKIFKTEESGQPGKSASDNLQVPQQGVKRKESPTDRPTDPDATSALYISDLYWWT:Sequence : EccccEEEcTTccEEEETccHHHcEEEEEcccTTc:Sec Str :XXXXX :SEG|46->65|ngigdggasggnnnatengn : ============:RP:SCP|109->192|1cvjA1|3e-09|20.5|78/80|d.58.7.1 : ==============================:BL:SWS|91->173|CPSF6_DROME|3e-07|33.3|81/652 : $$$$$$$$$$:RP:PFM|111->184|PF00076|4e-04|33.8|68/71|RRM_1 121: . . + . . .: 180 :TDDEIRGWINATGCEGELKDVTFSEHKVNGKSKGQAFVEFTSPQAATAAKHQIESLNAAQ:Sequence :cHHHHHHHHGGGcHHHcEEEEEEEEcTTTccEEEEEEEEEccHHHHHHHHHTEEEEcTcE:Sec Str :============================================================:RP:SCP|109->192|1cvjA1|3e-09|20.5|78/80|d.58.7.1 :===================================================== :BL:SWS|91->173|CPSF6_DROME|3e-07|33.3|81/652 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|111->184|PF00076|4e-04|33.8|68/71|RRM_1 181: . * . . . .: 240 :QSARKYSVNYTQPHTNPFRTLPKDNPMRGKDDRSRSSSAGFNSPVQGMNFGMGNTGGYRG:Sequence :ETTEEcEEEEccccTHHHHTcEEEEEcccTTccHHHHHHHHTccccEE :Sec Str : XXXXXXXXXXXX:SEG|229->262|nfgmgntggyrggrgggfnrggmnmggfnanrnf :============ :RP:SCP|109->192|1cvjA1|3e-09|20.5|78/80|d.58.7.1 :$$$$ :RP:PFM|111->184|PF00076|4e-04|33.8|68/71|RRM_1 241: + . . . . *: 300 :GRGGGFNRGGMNMGGFNANRNFSNPMGSGGFQGGAMGGAGFQGTPVGGMQPYGGFGNRGG:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXX :SEG|229->262|nfgmgntggyrggrgggfnrggmnmggfnanrnf : XXXXXXXXXXXXXXXXXX :SEG|266->283|mgsggfqggamggagfqg : XXXXXXXX:SEG|293->377|ggfgnrggmmgsnmrggpnmrgrggmggpmggnmmpvggmggvgmggmgmggmggmggmpnqmggmmggmqggmgmqgqgfqgqn 301: . . . . + .: 360 :MMGSNMRGGPNMRGRGGMGGPMGGNMMPVGGMGGVGMGGMGMGGMGGMGGMPNQMGGMMG:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|293->377|ggfgnrggmmgsnmrggpnmrgrggmggpmggnmmpvggmggvgmggmgmggmggmggmpnqmggmmggmqggmgmqgqgfqgqn 361: . . . * . .: 420 :GMQGGMGMQGQGFQGQNPHFNPAFFGQHGGSDGAWNPHGAKRTRQE :Sequence : :Sec Str :XXXXXXXXXXXXXXXXX :SEG|293->377|ggfgnrggmmgsnmrggpnmrgrggmggpmggnmmpvggmggvgmggmgmggmggmggmpnqmggmmggmqggmgmqgqgfqgqn