[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00411"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----322-----22311111111111111111111211111111111111111211111111111-11111111121-1111112111-111111111111-1111-2--37769761422444882637U4354A243344356-43239227475332693222134322532------------1-1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSMAYNSTVTRNIDMSRTEADLAVNIRKATSIEETAPKRKHVRSCIVYTWDHKSSASFWA:Sequence : cccccccHHHHHHHHHHHTccccccccHHHHHHHHHTTcHHHHHHHHHH:Sec Str : =========================================:RP:SCP|20->138|1hf8A2|9e-15|23.5|119/131|a.118.9.3 : ============================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->285|PF07651|3e-31|39.1|256/274|ANTH 61: . . . * . .: 120 :GMKVQPVLADEVQTFKALITVHKVLQEGHPITVKEAQSHVPWLDSLVRGVAGEGLRGYGP:Sequence :HHHHcccGGGHHHHHHHHHHHHHHHHHccHHHHHHHHHTHHHHGGGGcccccTTccccHH:Sec Str :============================================================:RP:SCP|20->138|1hf8A2|9e-15|23.5|119/131|a.118.9.3 :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->285|PF07651|3e-31|39.1|256/274|ANTH 121: . . + . . .: 180 :LIREYVFYLESKLAFHRQHPEFNGLFEYEEYISLKSINDPNEGYETITDLMALQDQIDAF:Sequence :HHHHHHHHHHHHHHHHHHcccTTTcccc cTTTcc HHHHHHHHHHHHHHHHH :Sec Str :================== :RP:SCP|20->138|1hf8A2|9e-15|23.5|119/131|a.118.9.3 : ==================:RP:SCP|163->281|1hf8A1|3e-14|13.7|117/132|a.7.8.2 :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->285|PF07651|3e-31|39.1|256/274|ANTH 181: . * . . . .: 240 :QKLIFSHFRGGANNECRISALVPLVQESYGIYKFITSMLRAMHTTTGDEEALEPLRGRYD:Sequence : :Sec Str :============================================================:RP:SCP|163->281|1hf8A1|3e-14|13.7|117/132|a.7.8.2 :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->285|PF07651|3e-31|39.1|256/274|ANTH 241: + . . . . *: 300 :AQHYRLVRFYYECSNLRYLTSLITVPKLPQQPPNLLAEDEDRPALPKRPSKEVEKEPTPP:Sequence : :Sec Str : XXXXXXXXXXXX:SEG|289->311|pskevekeptpppkstipdpepi :========================================= :RP:SCP|163->281|1hf8A1|3e-14|13.7|117/132|a.7.8.2 :================================================ :BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|21->285|PF07651|3e-31|39.1|256/274|ANTH 301: . . . . + .: 360 :PKSTIPDPEPINDFWSTEAKRQQEEYEAEQRRLQQQWEDQQRQQMLAQQQAQRDFEEQQR:Sequence : :Sec Str :XXXXXXXXXXX :SEG|289->311|pskevekeptpppkstipdpepi : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|321->383|rqqeeyeaeqrrlqqqwedqqrqqmlaqqqaqrdfeeqqrlqaeqqrlaqeqllrdqyqqqtq 361: . . . * . .: 420 :LQAEQQRLAQEQLLRDQYQQQTQGRLAELEQENLNARAQYERDQLLLQQYDKRVKDLEEQ:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXXX :SEG|321->383|rqqeeyeaeqrrlqqqwedqqrqqmlaqqqaqrdfeeqqrlqaeqqrlaqeqllrdqyqqqtq : X:SEG|420->432|qlnqlnsnynlqn : ========================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 421: . . + . . .: 480 :LNQLNSNYNLQNTSKDDQIRALQEQVNTWRSKYEALAKLYSQLRQEHLDLLQTTKSLKLK:Sequence : :Sec Str :XXXXXXXXXXXX :SEG|420->432|qlnqlnsnynlqn :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|452->615|PF09728|6e-04|34.8|141/294|Taxilin 481: . * . . . .: 540 :AASAQEAIDKRERLEREMKTKNLELADMIRERDRALHEKDRISGGNKEELEKVKRELRLA:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|527->539|keelekvkrelrl :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|452->615|PF09728|6e-04|34.8|141/294|Taxilin 541: + . . . . *: 600 :IERAENAERAKSSEISAMLSKYNREMADLEEALRNKNRALEEARNSTGERDHDHELTLRE:Sequence : :Sec Str :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|452->615|PF09728|6e-04|34.8|141/294|Taxilin 601: . . . . + .: 660 :KDEEIEVYKSGMEQALMELEELKLNQGDVDKALDTQIDDVLLSSVTKINDIIDSVLQSGV:Sequence : :Sec Str :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 :$$$$$$$$$$$$$$$ :RP:PFM|452->615|PF09728|6e-04|34.8|141/294|Taxilin 661: . . . * . .: 720 :QRVDDALYELDSTMQAGNQNASPPYVLSQIEKASASATEFSTAFNNFIADGPNSAHSEII:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|693->704|asasatefstaf :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 721: . . + . . .: 780 :RTVSVFSGSIADVLSNTKGLTRFATDDKKADQLINAARQSAQSTMTFFRALQSFRLQDLE:Sequence : :Sec Str :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 781: . * . . . .: 840 :PLQKTDVVINNNHEVALNLQKLSKLVDAFAPKSTKLNGTGDLGDLVDRELSNAANAIEAA:Sequence : :Sec Str : XXXXXXXXX:SEG|832->850|naanaieaaaarlaklkkk : ====================:RP:SCP|821->1008|1r0dA|9e-53|37.2|188/194|a.216.1.1 :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 841: + . . . . *: 900 :AARLAKLKKKPRDGYSTYELRIHDSILEASIAVTTAIAELIKAATASQQEIVREGRGSSS:Sequence : HTTccHHHHHHHHHHHH HHHHHHHHcccHHHHHHHHHHHHHHHHHHHH:Sec Str :XXXXXXXXXX :SEG|832->850|naanaieaaaarlaklkkk :============================================================:RP:SCP|821->1008|1r0dA|9e-53|37.2|188/194|a.216.1.1 :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|862->1054|PF01608|2e-42|61.1|190/192|I_LWEQ 901: . . . . + .: 960 :RTAFYKKNNRWTEGLISAAKAVATSTNTLIETADGVISGRNSPEQLIVASNDVAASTAQL:Sequence :HHHHHHHTTTcccTHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|821->1008|1r0dA|9e-53|37.2|188/194|a.216.1.1 :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|862->1054|PF01608|2e-42|61.1|190/192|I_LWEQ 961: . . . * . .:1020 :VAASRVKATFMSKTQDRLETASKAVGAACRALVRQVQAIIAEKNRDETEAVDYSKLSGHE:Sequence :HHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHHGGGcc :Sec Str :================================================ :RP:SCP|821->1008|1r0dA|9e-53|37.2|188/194|a.216.1.1 :============================================================:BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|862->1054|PF01608|2e-42|61.1|190/192|I_LWEQ 1021: . . + . . .:1080 :FKVREMEQQVEILQLENKLSQARQRLGEMRKISYLE :Sequence : :Sec Str :================================== :BL:SWS|17->288,397->1054|SLA2_SCHPO|e-153|48.9|927/1092 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|862->1054|PF01608|2e-42|61.1|190/192|I_LWEQ