[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00429"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------1111111111111111111122111111111111111-11111-11-----------------------1--------------------1-----------------------------------------------11------1-------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSSPSGPDALRITPRRRRGSAGAGPSPAHNTPSSILQQLAGMAGDPATPAGRSRRSLSAS:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|14->28|prrrrgsagagpspa : XXXXXXXXXXX:SEG|50->77|agrsrrslsasrvslrrssrgvsgigis 61: . . . * . .: 120 :RVSLRRSSRGVSGIGISDAFAGGSHAPATPHALKAFQRRAAVYTPGRDRRKSGRVQRETP:Sequence : :Sec Str :XXXXXXXXXXXXXXXXX :SEG|50->77|agrsrrslsasrvslrrssrgvsgigis 121: . . + . . .: 180 :LDILRNLGKALAPTSEVIKSSPMTETDQETDQQESEDLDEEPDLPRPRLSLPMHEMIVPG:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|144->169|tetdqetdqqesedldeepdlprprl 181: . * . . . .: 240 :DGDGSPEIVPPRLSLPLDEDDFTQRSIEMPRRERSTRDLATLSRYSLASTRFSEHFGDAS:Sequence : :Sec Str 241: + . . . . *: 300 :RLEYTEEGMEFTAPQGDDNFVDDQIELTAEQPIFDLGGETEDLRRFDLNFSFPTPDAPQH:Sequence : :Sec Str 301: . . . . + .: 360 :IENEHEDFVLDTTMPIADDVPVSSDDDFGAGDLELAVREGSPRPPLQESSPQPPQESRLD:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|341->359|sprpplqesspqppqesrl 361: . . . * . .: 420 :QNKERVSKHGIPVPKLPRGIVKRLATRFARTGNGSRTRISKEALAALEKATDWFFEQAND:Sequence :HcHHHHHHHccccccccHHHHHHHHHHHHHHHcTTcccccHHHHHHHHHHHHHHHHHHHH:Sec Str : =============================================:RP:SCP|376->447|1a7wA|3e-08|21.2|66/68|a.22.1.2 : ==========================================================:BL:SWS|363->467|YHLD_SCHPO|3e-14|41.2|97/479 421: . . + . . .: 480 :DLSAYSKHSNRKTVDETDVIALMKRQRQIGKGTSVFALAQKYLPKELLQDIRLAKK :Sequence :HHHHHHHHTTcccccHHHHHHHHHTTccHHHHTTTcccTT :Sec Str :=========================== :RP:SCP|376->447|1a7wA|3e-08|21.2|66/68|a.22.1.2 :=============================================== :BL:SWS|363->467|YHLD_SCHPO|3e-14|41.2|97/479