[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00708"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------33224462433311111112221111111111223115233321222212----1--2-1------11111------3------------------------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSSTVGGHLLPQNDFDIPLNLAASPSVSAIPDYSGNGGAYQIAAKLDSNPSQNATVKQQS:Sequence : :Sec Str : X:SEG|60->82|savgstvagaaaagrgagpatrp 61: . . . * . .: 120 :AVGSTVAGAAAAGRGAGPATRPDAPKSKRVRTGCLTCRERHLKCDETLPRCQNCQKSDRL:Sequence : cccccccccHHHHHTTcccccccccccHHHHTTcc:Sec Str :XXXXXXXXXXXXXXXXXXXXXX :SEG|60->82|savgstvagaaaagrgagpatrp : ############################:PROS|93->121|PS00463|ZN2_CY6_FUNGAL_1|PDOC00378| : ====================================:RP:SCP|85->128|1f4sP|4e-11|22.7|44/65|g.38.1.1 : =================================:BL:SWS|88->122|YOG2_SCHPO|2e-09|62.9|35/419 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|94->121|PF00172|2e-05|50.0|28/38|Zn_clus 121: . . + . . .: 180 :CKRGVRLNFIDTQVAAPPYAVPSSHDWQVNFHDESREIASEYLGGYERYPSLKKETPSRR:Sequence :cc :Sec Str :# :PROS|93->121|PS00463|ZN2_CY6_FUNGAL_1|PDOC00378| :======== :RP:SCP|85->128|1f4sP|4e-11|22.7|44/65|g.38.1.1 :== :BL:SWS|88->122|YOG2_SCHPO|2e-09|62.9|35/419 :$ :RP:PFM|94->121|PF00172|2e-05|50.0|28/38|Zn_clus 181: . * . . . .: 240 :AGPVYAYRETQAMATPHPGPTSASLLTPFAEHPQPDITAEPIFHGTPQAPAPDSAYTEHA:Sequence : :Sec Str 241: + . . . . *: 300 :MARSPFDAPKHPLAPANELRPYLNTAEEVLLMQVYVEEVGLWMDSMDPGKHVFNPSFGEE:Sequence : :Sec Str 301: . . . . + .: 360 :KALYYYNISTRDLLTCLQDPNRDTVLCATTAVVLNVYEVMCEKAMQRMNHIAGARALIKE:Sequence : :Sec Str 361: . . . * . .: 420 :CRWNAKTTGIGGACFWLNVGMELLSCLHFNWKMAWDPDTWDIDMNMSLNQGSIAGDEEFW:Sequence : :Sec Str : =====:BL:SWS|416->513|PFA4_EMENI|5e-04|36.2|94/435 421: . . + . . .: 480 :THRMLYICAKIANYRATMAYQGLDRSSHDPRLNQRCEEWNALRAWCDEWARCAPRSMMPL:Sequence : :Sec Str :============================================================:BL:SWS|416->513|PFA4_EMENI|5e-04|36.2|94/435 481: . * . . . .: 540 :GYLHPWETNSKSSFPEVWLIKRSAVVGRLFYHTACCLLAKVHPTESEYSDEMLSMQHSHA:Sequence : :Sec Str :================================= :BL:SWS|416->513|PFA4_EMENI|5e-04|36.2|94/435 541: + . . . . *: 600 :HDICGIVAHVKDRGVASVSIRCLAIAAECVVGREAQEEVIAILDKIIKETGWQVGFLQHE:Sequence : :Sec Str 601: . . . . + .: 660 :LIEKWGWNSATSHMSPHQSQHPQMAAAGPSTDLGSSLLNSALPSAPPSRPRMPQGIVNPL:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|635->653|ssllnsalpsappsrprmp 661: . . . * . .: 720 :MATADFSFDNHPYQNHYVAPHNNHLNNYHYGSY :Sequence : :Sec Str