[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00735"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------11111111111111111111111112111111111111111111111------------------------------1---------122------------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAGYGTIQGKFLRPFLELVSSVKDFDKELQNYVHHDYVKRKYQDLLGCSNVKLTNTSSLY:Sequence : :Sec Str 61: . . . * . .: 120 :ARYTTSVICNGIVQSSREICNVSPDDSRPLCADTCALSATSEELVAVNPDLCGTPKSNFM:Sequence : :Sec Str 121: . . + . . .: 180 :DQIRSDFTICANPADSLTGKCISGSENEPAECGYGPNLLGLCGFCAESSPNATDSCCVAA:Sequence : :Sec Str 181: . * . . . .: 240 :DATNRCRGLELPTVPSLPPLFPSSTSSSNPSASAGAGTGLSGGTIAGIVVGSVAGIALLG:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|191->262|lptvpslpplfpsstsssnpsasagagtglsggtiagivvgsvagiallgalavflfiflrrrrdrnssifn 241: + . . . . *: 300 :ALAVFLFIFLRRRRDRNSSIFNQPSPPRKGTSSMQYAPGNMAQGHGFDVLPGGRVARMSA:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXX :SEG|191->262|lptvpslpplfpsstsssnpsasagagtglsggtiagivvgsvagiallgalavflfiflrrrrdrnssifn 301: . . . . + .: 360 :LQNNDDSPRGTAAMKYDSSDSEAFASPASGTRRRPPVTGRRNGSLSSASALAGDGDTTSP:Sequence : cT:Sec Str : XXXXXXXXXXXX :SEG|330->341|gtrrrppvtgrr : XXXXXXXXXXXXXX :SEG|343->356|gslssasalagdgd 361: . . . * . .: 420 :KSGSGAQFSSPEGVASGQSEQLPYFRDYYSQDDIHPNDKVAVLWAYQPRAADEFELERGD:Sequence :TcHHHHHHHHHHTTcccccTTcEEEcccccccTTccccEEEEccccccccTTcccccTTc:Sec Str : ============================================:RP:SCP|377->483|1i1jA|2e-07|16.0|106/106|b.34.2.1 : ============================:BL:SWS|393->440|ARHG5_HUMAN|4e-05|37.5|48/1597 : $$$$$$$$$$$$$$$$$$:RP:PFM|403->440|PF00018|9e-04|40.5|37/47|SH3_1 421: . . + . . .: 480 :MLKVVGIWDDGWATGIRLNETVEDYDGKHKAQRDSGVSNGTDRRGSSPAPTGEIKAFPLV:Sequence :EEEEEEEccccEEEEEETTEEEEEcccccccccccccccc :Sec Str :============================================================:RP:SCP|377->483|1i1jA|2e-07|16.0|106/106|b.34.2.1 :==================== :BL:SWS|393->440|ARHG5_HUMAN|4e-05|37.5|48/1597 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|403->440|PF00018|9e-04|40.5|37/47|SH3_1 481: . * . . . .: 540 :CVCLPEHWRKTIEGDPQTRSSMDSQ :Sequence : :Sec Str :=== :RP:SCP|377->483|1i1jA|2e-07|16.0|106/106|b.34.2.1