[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00742"

            ""
            ""

OrgPattern -------------------------------------------------------------------- ----1---------11111-1111111111111111111111111-11------------111-1111111-----------1-------1--------11111-11111------------------------1-1--11----11111111----------111-111--1-----1----111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111111111-1-11-11-111111111111111------1-1111-1111111111-1111111--11111-111111111-1111111--111111-------------------111-11111111111111111111111111111111111111111111111111111111----11-------------1-----------------------1111-1--1------------------------11111111111111111111111111111111--1-11-------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111-11-111111111-1111111-1111111-----------1111111111111111111111---------2111111111111111111111111111111--111111----------------------------------------------111 ----111-----221111111121121-1-11111111-1-1-1111111111211111111111111-1111111111111111111-131111111111-1----1--212121111-111---111281-112111-1-11--112-11-11--1112--1111-1212121111-----111131111------1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPSGRVSARIVYLKELDERGWVVYSNWGSRAGKGGQVFGTETGIDVNGREEEEEVGEEGS:Sequence :TTTTEEEEEEEEccEEccccEEEEEEcTcccHHHHH cHHHHHHHH :Sec Str : XXXXXXXXXXXX :SEG|48->59|greeeeevgeeg : ===========================================================:RP:SCP|2->241|1ci0A|2e-26|52.1|163/205|b.45.1.1 :============================================================:BL:SWS|1->216|PDX3_SCHPO|7e-36|56.4|149/231 61: . . . * . .: 120 :VIPDDGQGKLEGNRWAALTFNWPSVERQVRVEGLIEMLSREESETYWRVRERGSQIGAWA:Sequence : TTcHHHHHHHccEEEEEEEETTTTEEEEEEEEEEEccHHHHHHHHHHccHHHHHHHHH:Sec Str :============================================================:RP:SCP|2->241|1ci0A|2e-26|52.1|163/205|b.45.1.1 :============================================================:BL:SWS|1->216|PDX3_SCHPO|7e-36|56.4|149/231 121: . . + . . .: 180 :SQQSKVLWSTEPRDMEGVDAVPGAASRLKDINSQSGEEDDGRSVLENRVKEMEKRFADTE:Sequence :ccTTcccccHHEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHTTccc:Sec Str :============================================================:RP:SCP|2->241|1ci0A|2e-26|52.1|163/205|b.45.1.1 :============================================================:BL:SWS|1->216|PDX3_SCHPO|7e-36|56.4|149/231 181: . * . . . .: 240 :EIPLPPFWGGVRLVPESVEFWQGRKSRLHDRFRYVRVHGENEHLGEGDEKTFRWRIQRLS:Sequence :cccccTTEEEEEEEEEEEEEEEccTTcccEEEEEEcccTTccEccTTTEcccTcEEEEcc:Sec Str : ############## :PROS|198->211|PS01064|PYRIDOX_OXIDASE|PDOC00815| :============================================================:RP:SCP|2->241|1ci0A|2e-26|52.1|163/205|b.45.1.1 :==================================== :BL:SWS|1->216|PDX3_SCHPO|7e-36|56.4|149/231 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|188->241|PF10590|2e-10|76.2|42/42|PNPOx_C 241: + . . . . *: 300 :P :Sequence :c :Sec Str := :RP:SCP|2->241|1ci0A|2e-26|52.1|163/205|b.45.1.1 :$ :RP:PFM|188->241|PF10590|2e-10|76.2|42/42|PNPOx_C