[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00774"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1111111-211-11111121111111111111111111211111111211111111111111111111111111111-2111111111-12111111111111111-1212111-12111114122111151-113111111121111--2111-1121--11-111111--11-111-111-1111111-2-11111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPESSAMKKSPKRRKTSSNDKADKDVITDPRFANIQSDPRYRLPSKKHTRVKIDKRFAHM:Sequence : ============================================:BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 61: . . . * . .: 120 :FHDKDFSRNAAVDRYGRKLRRDDTKKQLEKFYRLDKDDVEGQISADDDEEVQKELLRVEK:Sequence :================================ :BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 121: . . + . . .: 180 :EDYDPARDGGFSESSSSEESSSDEESEAELQDEAAESGQLDSQTGDIPLGEITDRIAVVN:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|132->157|sesssseesssdeeseaelqdeaaes : ===============:BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 181: . * . . . .: 240 :LDWDNIRAEDLMAVFSSFLPTGGKILNVAVYPSEFGKERMEREEMEGPPKEVFAKRDAEV:Sequence : XXXXXXXXXXXXXXXX :SEG|216->231|gkermereemegppke : XXXX:SEG|237->254|daevdsdveagddeeeee :============================================================:BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 241: + . . . . *: 300 :DSDVEAGDDEEEEEKIKQAILKEDEGQDFDSTQLRKYQLERLRYFYAVLTCSSKDAAKHI:Sequence :XXXXXXXXXXXXXX :SEG|237->254|daevdsdveagddeeeee :============================================================:BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 301: . . . . + .: 360 :YDTVDGTEYMSSANFFDLRFVPESTDFAEDVPRDECNRIPDGYKPNEFVTDALQHSKVKL:Sequence :============================================================:BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 361: . . . * . .: 420 :TWDTDDKARKDAQARAFKGGKKEIDENDLKAYLGSDSSDSEEEHVEVVDSTEAAGASTKL:Sequence : XXXXXXXXXXXXXX :SEG|363->376|dtddkarkdaqara : XXXXXXXXXXXXXXXXXX :SEG|395->412|sdssdseeehvevvdste :============================================================:BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 421: . . + . . .: 480 :SKKEAERARIRALLGLSNDAPSKAKEKGPVGDMEVTFAAGLTAAPARDSVFENEPEKEET:Sequence : XXXXXXXXX:SEG|472->504|enepekeettrekyirkererkqrrkaklkaak :============================================================:BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 481: . * . . . .: 540 :TREKYIRKERERKQRRKAKLKAAKSGTVPEIDADKPTAESKEEEDLGFDDPFFTAPELDS:Sequence :XXXXXXXXXXXXXXXXXXXXXXXX :SEG|472->504|enepekeettrekyirkererkqrrkaklkaak :============================================================:BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 541: + . . . . *: 600 :AKVAAKRKEEKRKQRQQREADGAASAAQRAELELLMMDDKTSTIKHFDMNEIEKAQKRAK:Sequence : XXXXXXXXXXXXXXXXX :SEG|544->560|aakrkeekrkqrqqrea : XXXXXXX:SEG|594->610|kaqkrakkagkhrkgkk :============================================================:BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 601: . . . . + .: 660 :KAGKHRKGKKDEATMPVDDFKVDVKDPRFQRIYESHEYAIDPTNPRFRQTDGMKALLEEG:Sequence :XXXXXXXXXX :SEG|594->610|kaqkrakkagkhrkgkk : XXXXXXXXXX :SEG|617->626|vddfkvdvkd :============================================================:BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|627->654|PF08159|9e-05|50.0|28/30|NUC153 661: . . . * . .: 720 :RKRRRHLAHDEPDGDAVEPIKKKKRGKTAGPDRMPETEDLSKLVEQVKAKAKMV :Sequence :==================================================== :BL:SWS|17->92,166->712|ESF1_SCHPO|1e-53|36.4|571/682