[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00779"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----1-------11111111111111111111111121112111111111111111111111111111-111111-1-1-1111-111-11111111111111111-1-112222311-1111111-1-252-1111-111-11111-1-2-11-1-111331111121121111-------------111--1----- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQQQRQPGLAVVIQGNGTSSRASQRLPRPLSVDEALQYSPMTSAPVFGLDSIMRPDVGQP:Sequence : :Sec Str 61: . . . * . .: 120 :SLSGWPRPYDSQVAGRITDSLDNETQASSGLGESTRLETAREYLQQLLRQDNLTDFNFKV:Sequence : :Sec Str 121: . . + . . .: 180 :PPSLRSDSSPQKNGESLSRSQLGPFAKLILDSTDATFHYSTPTTTNSEKHHQSSNTLPTP:Sequence : :Sec Str : XXXXXXXX:SEG|173->189|ssntlptplssskppys 181: . * . . . .: 240 :LSSSKPPYSANKEDQMRQQLEKLMKPMVIIPGLAPSSNIEDFKYVSGEGSAKRRKLDSNN:Sequence : :Sec Str :XXXXXXXXX :SEG|173->189|ssntlptplssskppys : =========:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 241: + . . . . *: 300 :EEKQDPLPLRDQKELSDTALVKLQSLLHEIFEAEEQLLPDAPLDAQAGGKFFKFPNTIGD:Sequence : :Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 301: . . . . + .: 360 :LGPIMSSETHEVLSKALQKVSDYRRLGDIPTEYIKHIQRLCEAPIMAVQSADFKLESPPS:Sequence : :Sec Str : =========================================================:RP:SCP|304->372|1rxdA|1e-04|25.0|60/150|c.45.1.1 :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 361: . . . * . .: 420 :DTDIERWITQLEDVQNALLAIITLLQTMPGNQSTKDLCPEDLIHAIPTALGQVFDHCIIP:Sequence : :Sec Str :============ :RP:SCP|304->372|1rxdA|1e-04|25.0|60/150|c.45.1.1 :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 421: . . + . . .: 480 :VVECRSSGKDSTHFHVFSAQKQVISNVIHQTKRVLSRLAVFLSNVDLAEGPITAIEFLAA:Sequence : :Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 481: . * . . . .: 540 :RLIFVENAPNDKESAIGVQKYEASRRAAMDVLAKIFAKYPEQRPFILDEILVSLEKLPSN:Sequence : :Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 541: + . . . . *: 600 :RQSARQFKLIDGKSIQLLSALVIQLVQTTALRQTSSRLTVAKGSLQKATNSLDESDEEDE:Sequence : :Sec Str : XXXXXXXXXXX:SEG|590->608|nsldesdeedeedsnngse :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 601: . . . . + .: 660 :EDSNNGSERKTSPIKQLSKQVELLYDNAIHSAQYVTKFIVQRAMTSTKSGDQPYRNLLDI:Sequence : :Sec Str :XXXXXXXX :SEG|590->608|nsldesdeedeedsnngse :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 661: . . . * . .: 720 :FTEDLISVLGSTDWPGAELILRVLASQMITIADHDKSSANAKNMSLELLGWMGSAISDLT:Sequence : HHHHHHHHcccHHHHHHHHHTTHHHHHHHHTTcc cHHHHHHHHHHHHHHTTcGGGTT:Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 721: . . + . . .: 780 :STAQHLSNTLEDGHTDLTDHLRNLFHDYSNRALHIQDIVSLDGPYRMTLEYLEEGDLGSW:Sequence :HHHHHHHHHHHcccHHHHHHHHHHHHHHcTTcHHHHHHHHHTTHHHHHHHHHHTcccGGG:Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 781: . * . . . .: 840 :QLSSARGYLIAQWAKLVCSGYEDSAQGGSTKNPQGAGKLAKALSHILSNPKWLESNSAFD:Sequence :cccHHHHHHHHHHHHHHHHHHHHHHGcccT HHHHHHcHHHTTcccHHHHHHHHH:Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 841: + . . . . *: 900 :RISTQQARFAYLIIVLSSGFCKGFDTIVKVLLNSITSDQAKVRSRSLKSVIHMLERDPSL:Sequence :HHHTTccccHHHHHHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHH:Sec Str : ====================================:RP:SCP|865->1009|1b3uA|3e-11|14.6|144/588|a.118.1.2 :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 901: . . . . + .: 960 :LDRDGSVISLILRCATDSSPMVRDSALSLIAKCMFLKPGLEENCCRAILACSSDPTVGVR:Sequence :HHHTTcHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHcHHHHHHHHHHHHHcTTccHHHH:Sec Str :============================================================:RP:SCP|865->1009|1b3uA|3e-11|14.6|144/588|a.118.1.2 :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 961: . . . * . .:1020 :KRAIGLMKDVYIQTSNQELKLTIIEQLLLRVTDYESSVAVQASQALEEIWFSPLHSSFTE:Sequence :HHHHHHHHTTTccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHTccHHHHHHHHHHT:Sec Str :================================================= :RP:SCP|865->1009|1b3uA|3e-11|14.6|144/588|a.118.1.2 :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1021: . . + . . .:1080 :STQGTPQSKVSLKNLMNLIVGSVRRNEGVIATFEAFVKDELSAEAKSASLNFNVCKAVVA:Sequence :cccHHHHHHHGGGHHHHTTTccHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHTHHH:Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1081: . * . . . .:1140 :AMFDRIIHDSDKTDKRTLQSLLQSITVFARANAKLFTPDQLETLHPYIGHLSNADDLMLF:Sequence :HHHHHHTcccHHHHTTHHHHHHHHHHHccHHHHHHHTHHHHHHHHTcHHHHHHHHcHHHH:Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1141: + . . . . *:1200 :RSVVVIYRCVLPYLSTSHNTLLKDIQNDLFKSVSKLARTELNEVMACLWTINGVLQNTER:Sequence :HHTHHHHHHHHHTcccHHHHHHHHHHHHHHHHTccTTTHHHHHHHTHHHHHHHHHTcccH:Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1201: . . . . + .:1260 :LVKLTISVLKGINQAVSAKVDPSTSADVLGRVRSYIRIAGCVGKHCDLESFLAFFSQSFP:Sequence :HHHHcHHHHTTGGGGHHHHcHHHHHHHTHHHHHHHHTcccHHHHHHHHTTcHHHHHHccH:Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1261: . . . * . .:1320 :HMKATSVSGLMVDFISPFASSKYPHELRVMALESLGAICETWPAQYSREPAKIAFTSVFE:Sequence :HHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHcGGGccHHHHHHHHHGGG:Sec Str :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1321: . . + . . .:1380 :EDSPDLQNIVLKGFLAFFSIHEGKSEKLIQTKDTNGKSEGSTRLGGSLKASENDGAAALI:Sequence :cccHHHHHHHHHHHHHHHHHHH :Sec Str : ========:RP:SCP|1373->1509|1wyeA1|4e-04|17.1|129/308|c.72.1.1 :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1381: . * . . . .:1440 :AQHFLQQMLHAALSKEDSHALTGIELIASINRQGLIHPKECAGVLVALETSTNASIANVA:Sequence : :Sec Str :============================================================:RP:SCP|1373->1509|1wyeA1|4e-04|17.1|129/308|c.72.1.1 :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1441: + . . . . *:1500 :FETHKMLHQQHESMFDREYMRAVQDAFYYQRDVVGDPTGASTRPFTAKLAALFEIIKISN:Sequence : :Sec Str :============================================================:RP:SCP|1373->1509|1wyeA1|4e-04|17.1|129/308|c.72.1.1 :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1501: . . . . + .:1560 :SKYQKKFLTNLCSKVDFQPRALDVAGSPPEHMLLARFVCQNLAYFEYAQIGELLATVACM:Sequence : :Sec Str :========= :RP:SCP|1373->1509|1wyeA1|4e-04|17.1|129/308|c.72.1.1 :============================================================:BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1561: . . . * . .:1620 :ERIVASTGTTVAHAIETDIFPVKIDCPNEQMQVDGAAADQAPHSVDPNSLKQLATAAATL:Sequence : :Sec Str :=========== :BL:SWS|232->1571|MIS4_SCHPO|2e-73|24.7|1243/1583 1621: . . + . . .:1680 :SMLWETRTYLRRLYGVGFHSMPKESKASAKDLNKSLTKVQGIGGDRLWDAISKTMASLEN:Sequence : :Sec Str 1681: . * . . . .:1740 :TEGMTRVCREFATLMSIDDELRVAADDDRDGNDSAADFGNMSAMLGATNGSRPSKRRSSV:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|1704->1717|aadddrdgndsaad : XXXXXXXXXX:SEG|1731->1742|srpskrrssvss 1741: + . . . . *:1800 :SSGNAPKRPRQKGRPKNTKKRGSTDSEQDGDFD :Sequence : :Sec Str :XX :SEG|1731->1742|srpskrrssvss