[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00781"

            ""
DOHH_COCIM  "RecName: Full=Deoxyhypusine hydroxylase;         Short=DOHH;         EC=1.14.99.29;AltName: Full=Deoxyhypusine monooxygenase;AltName: Full=Deoxyhypusine dioxygenase;"

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 11--211-311-1111111111111111111111111111111111211111111111211111111111111111111111111111-1211111111111121111213331121----11-21-11211-111-11-11111-1--21--111---111111111114111111116111111222111-111112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASTIADNADNNGNSKDSVQYLRKVLTSESSPLAQRFRALFSLKHLASSKPPTEETLPAI:Sequence : :Sec Str :============================================================:BL:SWS|1->335|DOHH_COCIM|e-162|99.7|335/335 61: . . . * . .: 120 :EAIAAAFSSPSALLKHELAYCLGQTRNLDTVPHLRKVLEDTQEDAMCRHEAAEALGALGD:Sequence : :Sec Str : XXXXXXXXXXX:SEG|110->125|eaaealgalgdagsld :============================================================:BL:SWS|1->335|DOHH_COCIM|e-162|99.7|335/335 121: . . + . . .: 180 :AGSLDILQRLRDDESEEEVVRETCDIAVDRILWETSKDSKSEKLKQSDFTSIDPAPPLPL:Sequence : :Sec Str :XXXXX :SEG|110->125|eaaealgalgdagsld : XXXXXXXXXXXX :SEG|131->142|rddeseeevvre :============================================================:BL:SWS|1->335|DOHH_COCIM|e-162|99.7|335/335 181: . * . . . .: 240 :SSAEQSIPELKQILLDASLPLFKRYRAMFALRDMCSPPDLPTAVPAIEALAEGFKDRSAL:Sequence : HHHHHHHHHHcccHH:Sec Str : ==========================================================:RP:SCP|183->322|1l5jA1|3e-07|13.1|130/160|a.118.15.1 :============================================================:BL:SWS|1->335|DOHH_COCIM|e-162|99.7|335/335 241: + . . . . *: 300 :FRHEIAFVFGQLSHPASIPSLVATLSDKNEVGMVRHEAAEALGSLGAEDGVEETLKRFVN:Sequence :HHHHHHHHHHHHHHHcHHHHHHHHHTcTTccHHHHHTTTccccHHHHHHHHHHHHHHccH:Sec Str : XXXXXXXXXXXX :SEG|277->288|eaaealgslgae :============================================================:RP:SCP|183->322|1l5jA1|3e-07|13.1|130/160|a.118.15.1 :============================================================:BL:SWS|1->335|DOHH_COCIM|e-162|99.7|335/335 301: . . . . + .: 360 :DPETVVRDSIIVALDMAEYEKSGEQEYILEQPVAA :Sequence :HHHHHHHHHHHHHH :Sec Str :====================== :RP:SCP|183->322|1l5jA1|3e-07|13.1|130/160|a.118.15.1 :=================================== :BL:SWS|1->335|DOHH_COCIM|e-162|99.7|335/335