[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00795"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGSETGKMTKTDAPKVCRNQRTTVGQPSPASNGQQKGGKRRKKKKKKKKKKKKKKNAMAR:Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|36->55|kggkrrkkkkkkkkkkkkkk : X:SEG|60->72|rvgvrgggrtgcg 61: . . . * . .: 120 :VGVRGGGRTGCGWSEAYRRKRSEPLSEEENPRIKKIYRKESRRVRHAGPGEEMKRRLPAC:Sequence :XXXXXXXXXXXX :SEG|60->72|rvgvrgggrtgcg 121: . . + . . .: 180 :HRETEMREVKGNRGLAAQTRRAACGF :Sequence