[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01208"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----1-2-----11111121111111111111121111111111111111111111112111111111111111111-1111111111-11111111111-21---11-11111126333332347193CP7-8372332523331333231261123411179N1121111411-----1111-----1----11-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEQSSPLAAMQPPSVMLRHHFRSEAKAGCSSFPAVRKFGPDSFNFRDLSMKTGHSDYFNT:Sequence : :Sec Str :============================================================:BL:SWS|1->551|MPIP_EMENI|e-171|61.2|546/556 61: . . . * . .: 120 :KALRGSSPTVSLAADLSQNFHIDKSPQLATPRRSLFTASLFGPENGRDNMTTPPLPSSSP:Sequence : :Sec Str : XXXXXXXX:SEG|113->122|pplpssspap :============================================================:BL:SWS|1->551|MPIP_EMENI|e-171|61.2|546/556 121: . . + . . .: 180 :APNMEIMDMSPLPHKIPYCHNADLDLDSPTTEISLAKSQQVHAQLSLEDSPMDLEPPGRP:Sequence : HHHHHHHHHHTcEEEEEGGGTcTTcccEEEEEEEccccTTcGGGGcTTHHHHHHccc:Sec Str :XX :SEG|113->122|pplpssspap :============================================================:BL:SWS|1->551|MPIP_EMENI|e-171|61.2|546/556 181: . * . . . .: 240 :QRHKPPILRPSLMRSKAYSSGDKGSLAPQPPPFRFAAGSSKPTACSSLSLSEMFEQSPPR:Sequence :cccccEETEETTcccccccccTTcTTccccHHE HHHHHHHHHHcccEEcHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->551|MPIP_EMENI|e-171|61.2|546/556 241: + . . . . *: 300 :ESSPRFLTSISMGPPRPRAPFSGVVGQCRSNGSPVNGIRKSSNPFCRPRKQSRRSLSMFE:Sequence :HcHHHHHHHHcccccccccHccccccGGGccHHTcccHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->551|MPIP_EMENI|e-171|61.2|546/556 301: . . . . + .: 360 :HPEDIVNQEEDTIMSSPGLQPIADIDSQPTLQLPHFIPEDGPDQLPRVESSVLVDIINGK:Sequence :HHHHHHTTcccGGGccccccccTTcccccccETTccccccccTTccEEcHHHHHHHHTTT:Sec Str : =======================================:RP:SCP|322->480|1c25A|2e-27|37.3|153/161|c.46.1.1 :============================================================:BL:SWS|1->551|MPIP_EMENI|e-171|61.2|546/556 361: . . . * . .: 420 :YNDCYDKIMIIDCRFEYEYEGGHINGAVNYTDKEHLAAELFDQEPKPSTALIFHCEYSAH:Sequence :TTTTEEEEEEEEcccHHHHHTcEETTcEEcccHHHHHHHTTTccTTcEEEEEEEcccccc:Sec Str :============================================================:RP:SCP|322->480|1c25A|2e-27|37.3|153/161|c.46.1.1 :============================================================:BL:SWS|1->551|MPIP_EMENI|e-171|61.2|546/556 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|368->461|PF00581|9e-05|31.7|82/108|Rhodanese 421: . . + . . .: 480 :RAPIMAKYIRHRDRAVNVDIYPKLTYPEMYILNGGYSSFFAEHRALCYPQNYVEMSAKEH:Sequence :HHHHHHHHHHHHHHHTccHcTTccccccEEEETTHHHHHHHHHGGGEEcccccccccccc:Sec Str :============================================================:RP:SCP|322->480|1c25A|2e-27|37.3|153/161|c.46.1.1 :============================================================:BL:SWS|1->551|MPIP_EMENI|e-171|61.2|546/556 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|368->461|PF00581|9e-05|31.7|82/108|Rhodanese 481: . * . . . .: 540 :EFACERGLGKVKQRSKLSRAQTFAFGQNSLQIEESPTGRCRPVGDRSCDPDAPFDRDVEV:Sequence :HccHHHHHHHTTccc :Sec Str :============================================================:BL:SWS|1->551|MPIP_EMENI|e-171|61.2|546/556 541: + . . . . *: 600 :TRLPGRRMFSY :Sequence : :Sec Str :=========== :BL:SWS|1->551|MPIP_EMENI|e-171|61.2|546/556