[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01223"

            ""
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1111221-1---22333333333333221322322233132233332233333323333333222--11311222-1--1-3332221-23332432222232493-1124E955522131221B6181BK5-5372221412422322332-9332342342222283226722-221I11113ADJG3H92121121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDPETEAQIAQWQSAYMSKDESNQIAASNGKAGVGRRDDASSATGANTGPLGNIQRLQDG:Sequence : :Sec Str 61: . . . * . .: 120 :STISTPPSVAQTTSTTPIPGQPNAPNQSGPGKTVMRSGGGQTWTDSTLLEWDPAHFRLFC:Sequence : HHHHHHHcccccccccGGGTTEEccccccccccEccEEEETcccccEEEE:Sec Str : ===:RP:SCP|118->192|1cvjA1|1e-22|33.3|75/80|d.58.7.1 : ==========================:BL:SWS|95->197|RBM42_XENLA|1e-33|58.3|103/392 : $$$:RP:PFM|118->188|PF00076|4e-16|45.1|71/71|RRM_1 121: . . + . . .: 180 :GNLAGEVTDDSLLKAFSKYPSVQKARVIRDKRTEKSKGYGFVSFSDGEDYFRAAREMQGK:Sequence :EcccTTccHHHHHHHHGGGccEEEEEEEEcTTTccEEEEEEEEEccHHHHHHHHTTcccc:Sec Str :============================================================:RP:SCP|118->192|1cvjA1|1e-22|33.3|75/80|d.58.7.1 :============================================================:BL:SWS|95->197|RBM42_XENLA|1e-33|58.3|103/392 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|118->188|PF00076|4e-16|45.1|71/71|RRM_1 181: . * . . . .: 240 :YIGSHPVLLRRAMTEIRPVVVGKGGAKGHKKGGNTSGSGAGGGKASKAGGKAPDSGIQKK:Sequence :EETTEEcEEEEccccccH :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|199->236|vvvgkggakghkkggntsgsgagggkaskaggkapdsg :============ :RP:SCP|118->192|1cvjA1|1e-22|33.3|75/80|d.58.7.1 :================= :BL:SWS|95->197|RBM42_XENLA|1e-33|58.3|103/392 :$$$$$$$$ :RP:PFM|118->188|PF00076|4e-16|45.1|71/71|RRM_1 241: + . . . . *: 300 :QAKTKGGLRVLG :Sequence : :Sec Str