[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01232"

            ""
            ""

OrgPattern -------------------------------------------------------------------- ------11111--1-----------------------1--------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------1-------------------------1--1----1-------1---1111----------1-1-----------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----11--211-11111221111111-111111111111111111122111111111111111-----------------------11-1-111111111-1-22---1121111-1111111111121181-111111111--1111-11--11111---11111-1111--11--1-4-111111122111-11111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGPTSFPFNQVPERLRMVPAEKLSPYERAPAAVRELYSECRRLSALQIDSHPQILDFQGL:Sequence : :Sec Str 61: . . . * . .: 120 :NKDRLPDGIVLKECIPPSSLELAFDEFMGSNSWRKDLRDGRDGACVYGIRQVPGLRILPS:Sequence : :Sec Str 121: . . + . . .: 180 :LLPPAVQTELLSRLLHRDLSDERHQTNLHLHYDVSYPSPSSDANGASALKGTQQEACWST:Sequence : :Sec Str : XXXXXXXXXXXXXXXX :SEG|129->144|ellsrllhrdlsderh 181: . * . . . .: 240 :NSSFFRDDPTRTFSPKDATVHRPLSIQAALNSKLRWITLGGQYNWTTKEYPPGPPPAFPS:Sequence : HHHHHHHHccccccccTTccccccEEEEEEccEEEEccccEEEEcccTTTcccccccH:Sec Str : =============================:RP:SCP|212->337|2iuwA1|7e-15|26.2|126/202|b.82.2.10 : =======================================:BL:SWS|202->373|ALKBH_SCHPO|5e-41|53.1|162/297 241: + . . . . *: 300 :DISTLLHSIFPETTAEAAIVNLYSPGDTLNPHRDVSEECDTGLISISLGCHALFLVGHGN:Sequence :HHHHHHHHHHHHTcccEEEEEEEcTTccEEEEccccccTTccEEEEEEEccEEEEEcccc:Sec Str : ########### :PROS|289->299|PS00639|THIOL_PROTEASE_HIS|PDOC00126| :============================================================:RP:SCP|212->337|2iuwA1|7e-15|26.2|126/202|b.82.2.10 :============================================================:BL:SWS|202->373|ALKBH_SCHPO|5e-41|53.1|162/297 301: . . . . + .: 360 :GDSCAVIRLRSGDAVYMTGASRFAWHAVPKIIPSTCPDWLKTWPGGGDVPDEDSQRWWGW:Sequence :TTcccEEEEcTTcEEEEcGGGTTccEEEccccccccT T:Sec Str :===================================== :RP:SCP|212->337|2iuwA1|7e-15|26.2|126/202|b.82.2.10 :============================================================:BL:SWS|202->373|ALKBH_SCHPO|5e-41|53.1|162/297 361: . . . * . .: 420 :MAGKRVNLNVRQMFQSPPTNPAALGEND :Sequence :TcccEEEEEEEcc :Sec Str :============= :BL:SWS|202->373|ALKBH_SCHPO|5e-41|53.1|162/297