[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01275"

            ""
            ""

OrgPattern --------------------------------------------------------------1----- -1112---------1---------1------1111111----------------------1-1-1-1111-------------------------------------1-----------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11--1----------1------1---11-------------1----------1----------------1-2-----------------------------------------1111-11111----1111-11--------111------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------1-1-------------------------1-------------------------------------11111------------------------------------------------------------------------- ----------------1111111111222222211111-11112222211123211111111------------------------------1---111-------------------------------------------------------------------------------------2----1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGKSLVYPKRESNTMNRYKHRGTYDLGPIHSIINSAPVLHVSFSPSPDDPFPAILPMIGQ:Sequence : :Sec Str : XXXXXXXXXXX :SEG|42->52|sfspspddpfp : ========================================:RP:SCP|21->240|2furA1|1e-40|26.9|186/193|b.45.1.1 61: . . . * . .: 120 :MGSFEYPSSGIDDPLECYLHGYVSSRIMNLARATDGKGLPICIAATHVDGLILTLTPNSH:Sequence : EEEccEEEEEEccEEETTTTEEEEEEETTcHHHHHHHHHcEEE:Sec Str :============================================================:RP:SCP|21->240|2furA1|1e-40|26.9|186/193|b.45.1.1 121: . . + . . .: 180 :SYNYRSAVLHGYATLVTDVEEKLWAMKLITNSVVPQRWENTRIPPDGAEMQSTTILKVKI:Sequence :EETTEEEEEEEEEEEEccHHHHHHHHHHHHcccccccEEGcEEEEEEEEETTEEEEEEEc:Sec Str :============================================================:RP:SCP|21->240|2furA1|1e-40|26.9|186/193|b.45.1.1 181: . * . . . .: 240 :VDGSGKIRDGGVSDERKDKDRPDVTEKVWTGVVPVWQTFGEPVPDGLNKVNEVPEHISSY:Sequence :cEEEEEccTTccEEEc ccccccEEEEccccccc :Sec Str :============================================================:RP:SCP|21->240|2furA1|1e-40|26.9|186/193|b.45.1.1 241: + . . . . *: 300 :IERMNEQNRKCAFDAIKVPLPKEEQH :Sequence : :Sec Str