[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01290"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------- --1-----51232-4---1-11112121111111123111111111-----1-1112--3-1-1-121-1-12--22-11---1--11-------------11------116244641---33255-B1AS6298N11--9-14413---4--31224534M---1-142223-------221---1-11------13- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDQTADLENRQLSPANIDDNVGLSPTSKKVLGHCAVKVVTSPTKDFRTLIARPPNSSLDG:Sequence : :Sec Str 61: . . . * . .: 120 :NSSFHFARPNHPAPSFSIRPLPRAAREDGGIGRGISVPIAANISAMSIMEPNSSQNDITP:Sequence : :Sec Str 121: . . + . . .: 180 :TVESTEGDLGNEPSSTSPQPQIEPMQAFAATQSCPNASPDTNLCIDSQAREAEPRVRSER:Sequence : :Sec Str 181: . * . . . .: 240 :IANSLTKETGSTTSKISKQQRLRTPSRLSKDTGKTSSLPSQPSEEDLFYLLIHRLKKRDQ:Sequence : :Sec Str 241: + . . . . *: 300 :VEAATAALREETEKKLREVNEENEALKSQLREAEDRCHAQETQNTAQRNIIERWKVKLGK:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|242->253|eaataalreete : ==========================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 301: . . . . + .: 360 :VKSLVAIIGNDHEILRKDGQFLKSAQIALVRGKHQLQTDLRHLKCGTDHLSKAVTQQRAE:Sequence : :Sec Str :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 361: . . . * . .: 420 :LASMQAKFTVLEQSLALRDNRLENSEKLLEREKNHTSTLEAFIRNHSNRGLKQIALLQQT:Sequence : :Sec Str : =====================:RP:SCP|400->629|1i1qA|4e-04|12.5|224/513|d.161.1.1 :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 421: . . + . . .: 480 :QTETASNVGNLAEGIKNLLTESQSTIKVELGLQLKPCLEILETLSKPESIDLAQLAQIDK:Sequence : :Sec Str :============================================================:RP:SCP|400->629|1i1qA|4e-04|12.5|224/513|d.161.1.1 :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 481: . * . . . .: 540 :ALRDISMKVDSQNQKTELHVASGFDVQNQQASRIIQQLSDMRVFFEESSTASIKLADTKQ:Sequence : :Sec Str :============================================================:RP:SCP|400->629|1i1qA|4e-04|12.5|224/513|d.161.1.1 :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|509->666|PF05335|3e-05|23.9|155/188|DUF745 541: + . . . . *: 600 :TNGMLQEKVKIAEATLAQINVENAILKETESSLRNDVSALQKEVESLQNQLADACQSSED:Sequence : :Sec Str :============================================================:RP:SCP|400->629|1i1qA|4e-04|12.5|224/513|d.161.1.1 :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|509->666|PF05335|3e-05|23.9|155/188|DUF745 601: . . . . + .: 660 :RHELSKLRIQFKEISAVLDDATAKLKAKEEEVSKLEAGLSETKSRLQNSETQILNLETEK:Sequence : :Sec Str :============================= :RP:SCP|400->629|1i1qA|4e-04|12.5|224/513|d.161.1.1 :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|509->666|PF05335|3e-05|23.9|155/188|DUF745 661: . . . * . .: 720 :AKFEKDTISIENRVRAEFTKASLLSTEQNRAWFEQQLYQIKREKATAEKSANMLKEQTAL:Sequence : :Sec Str : XX:SEG|719->733|allksklaaagssqs :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 :$$$$$$ :RP:PFM|509->666|PF05335|3e-05|23.9|155/188|DUF745 721: . . + . . .: 780 :LKSKLAAAGSSQSELEITVTENAKMMNDLESTRQEEITDLDEVVFKLKDEKTFHAMDAEE:Sequence : :Sec Str :XXXXXXXXXXXXX :SEG|719->733|allksklaaagssqs :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 781: . * . . . .: 840 :AKSSLQRALAENAKMKIELVEAQSWMESSCQLSLLQEKFDLMRDESVQKDENIAFLTNEI:Sequence : :Sec Str :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 841: + . . . . *: 900 :ATLKDNATVTERLREEAAQGTLELKDLRKKLEDAHKENMELTERLKSRDDDTACRTAELD:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|862->873|lelkdlrkkled :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 901: . . . . + .: 960 :LSKQEENMVNLHQTIRGKDSELQKLQGRLDRAEESLTKIEGLLRQFGILGANDLLVQSWV:Sequence : :Sec Str :============================================================:BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 961: . . . * . .:1020 :TLERRLSYFARLPESSEMLLDADTDEVSLQGSKSTGKRKRIANLTPSIERKTSPRCSTPG:Sequence : cccccccccHHHHHHH:Sec Str :==================================================== :BL:SWS|259->1012|CP135_MOUSE|2e-15|22.8|689/1140 1021: . . + . . .:1080 :YKTTRVVYRKESISRSISCSPLKPQVQKRSASKKKHTRITTPRIKPFSQVQWDLDGRRSS:Sequence :HHHHHHcccccEEEEEEETTEEEEEEEEEEHHHHHHHTccEEEEcT HHH:Sec Str : ============:BL:SWS|1069->1190|DYTN_HUMAN|7e-04|31.1|119/578 1081: . * . . . .:1140 :PSQSIDYLSNTPVYESWRVANIPASTPKLQQGNSSTPMTKLPPSPIKDVKVESHMIHRNY:Sequence :HTccccccccccEEEcccccccHHHHHHHHHHHHHHccTTccEEEE :Sec Str :============================================================:BL:SWS|1069->1190|DYTN_HUMAN|7e-04|31.1|119/578 1141: + . . . . *:1200 :ADESLYTPQEKNQNLEEIKGSSQAEKGQKLPKSILKEPALPALAGREDNEVHTSSRMESQ:Sequence : :Sec Str :================================================== :BL:SWS|1069->1190|DYTN_HUMAN|7e-04|31.1|119/578 1201: . . . . + .:1260 :KTKEAGAPAVPRRQTRASSQYFKSSDNPSTILSSSRHTWAITQSAESSMGYRRPRRYGRK:Sequence : :Sec Str : XXXXXXXXXXX:SEG|1250->1267|gyrrprrygrkkgrgyky 1261: . . . * . .:1320 :KGRGYKYSLHPGSTNSKQENCTTIGSNKIIQNNGRRIKKV :Sequence : :Sec Str :XXXXXXX :SEG|1250->1267|gyrrprrygrkkgrgyky