[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01298"

            ""
ATG13_COCIM  "RecName: Full=Autophagy-related protein 13;"

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------11111111111111111111111111111111111111111111111111111111-1--1-1------1111111----11-11-1----111-1---------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQNYHTKAALVILHSRVDLSPATYHGVIRTNKWFNVEVNETEDLKDSLGVWKYSNCTDSR:Sequence :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->235|PF10033|1e-41|46.2|223/227|ATG13 61: . . . * . .: 120 :PPPLIIEVYLDLTQLTNNQSLVIIDDSGKRWDVVEALATYGCLDNSRTSKSGVILERWRI:Sequence :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->235|PF10033|1e-41|46.2|223/227|ATG13 121: . . + . . .: 180 :DLGPGPDDLPLDMGSILPTVYKKSIVVFRSLYAYSKLLPAWKYSKRHSKIRPNPALSLKY:Sequence :XXXXXXXXXXXXXX :SEG|121->134|dlgpgpddlpldmg :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->235|PF10033|1e-41|46.2|223/227|ATG13 181: . * . . . .: 240 :RILQGPGGQIRSTNDPLTVPLHPGNGPVVDTYSFGVTDSPAGPLSALVTYRTNCDFRVDD:Sequence :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->235|PF10033|1e-41|46.2|223/227|ATG13 241: + . . . . *: 300 :SEALLSSRFMGVDERFFKPSLPSEDNFAAAGQEHGSLPVQKRDVGRPDLGQAYGSMSTFH:Sequence :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 301: . . . . + .: 360 :QVGATTGASPISALRAARELAAGSPSSPTRPSHSPRPSQAGRVAALSGEGNHLIQRRPSI:Sequence : XXXXXXXXXXXXXXX :SEG|324->338|spssptrpshsprps :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 361: . . . * . .: 420 :SIQPFKAPPLSASPALVDSPVGSQPKNSAPRVGPMDITSSARQMPPPHGTPTTSRRSAHV:Sequence :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 421: . . + . . .: 480 :SESAIASSTSGSPRPAPISKYSSSFSHRRGRLSSGGASKTDDDNNSSGRVSVSSSTVHPG:Sequence :XXXXXXXXXXXX :SEG|421->432|sesaiasstsgs : XXXXXXXXXXXX :SEG|466->477|ssgrvsvssstv :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 481: . * . . . .: 540 :SGTSADPATTSSGSLQADEDNISDFLKMLEMGKDLLSRKDSKSLDKNTKRTSAALSRFQK:Sequence :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 541: + . . . . *: 600 :MRDSNAVLSDSMSSSLLLQPSSISSSKQLPNAATSVAGASISVSSSPGKAISPHTQHIPA:Sequence : XXXXXXXXXXXXXXXXXXXXXXX :SEG|544->566|snavlsdsmssslllqpssisss : XXXXXXXXXXXXXXXXXXXXXX :SEG|572->593|aatsvagasisvssspgkaisp :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 601: . . . . + .: 660 :VPSRLSSNSVVDYSHSHEDRHERRHRLSHESRRSPSEERANDEPRLKRDESTANAIDIPT:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|614->639|shshedrherrhrlshesrrspseer : XXX:SEG|658->681|iptsprpfipsfrrsssaaqrrss :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 661: . . . * . .: 720 :SPRPFIPSFRRSSSAAQRRSSPPVEDDLGDFLPFGMRSLSLGAEDRSTLSLSELVRQQES:Sequence :XXXXXXXXXXXXXXXXXXXXX :SEG|658->681|iptsprpfipsfrrsssaaqrrss :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 721: . . + . . .: 780 :SVPASDTNALQQQNQKDTRTGQSIVDESPSRIDNVPGTSSPRQYQPRFAHGRGRGSFGHP:Sequence :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 781: . * . . . .: 840 :QPHVSAASSLGRASPIPNVTDADRERYIGSGNNGGTAVPPDTRRGSSHRFSFNRHLGTPA:Sequence :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 841: + . . . . *: 900 :NMDEDEPLLFAMSDFGASRRSLEEGRKGATTAGADHGGAPSTELQPAAETRSEGGPPSVS:Sequence : XXXXXXXXXXXX :SEG|868->879|gattagadhgga :============================================================:BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980 901: . . . . + .: 960 :RGRYRAWP :Sequence :======== :BL:SWS|1->908|ATG13_COCIM|0.0|99.8|908/980