[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01626"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------11111111111111-111111111111-111111121111111111------------------------11-111111111111-1--------------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MESEAKDPSAENGSKQKKPKKTKSTTSLSGIFKRSQRGKKGNSCEKEDKENVTMARGSND:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|14->27|skqkkpkktkstts 61: . . . * . .: 120 :MPPPPIPRSRAQSIQSQISSRYVSSGRTVEEEMSLYTPRGYSPSSQRNFYDFQQPSLTKR:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|66->85|iprsraqsiqsqissryvss : ================================:BL:SWS|89->230|RTN2_YEAST|2e-04|26.1|134/393 121: . . + . . .: 180 :PDSKWRPKSEYGSSSTSSVKDILQSIHRRSPSAGSVKSNASRTHPLAERPPSEKRKSSNG:Sequence : :Sec Str :============================================================:BL:SWS|89->230|RTN2_YEAST|2e-04|26.1|134/393 181: . * . . . .: 240 :NRGSRVMAAIAAFSAKDKNFDKPKPVDPKEIDSEFERLLDARNIPHNMRDRMRSLNTNIK:Sequence : :Sec Str :================================================== :BL:SWS|89->230|RTN2_YEAST|2e-04|26.1|134/393 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->406|PF06371|3e-26|46.7|152/190|Drf_GBD 241: + . . . . *: 300 :ADFINKNQIEGECSSASASAQRQFVTTSHKRTKSKDSSFGRSENRGTKKRPKSADLSIPS:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->406|PF06371|3e-26|46.7|152/190|Drf_GBD 301: . . . . + .: 360 :RLPSGGLNPALPSPDLIADPTDFVHYLKEVQKPEIVEVSKLHKLRILLRNETISWVESFI:Sequence : HHHHHHHHTccccHHHH HHHHHHHHHHHHHccHHHHHHHH:Sec Str : =========================================:RP:SCP|320->626|1z2cB1|2e-09|18.8|224/346|a.118.1.23 : =========================================:BL:SWS|320->599|RID1_SCHPO|8e-31|33.1|257/367 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->406|PF06371|3e-26|46.7|152/190|Drf_GBD 361: . . . * . .: 420 :SHGGMEQLVDLLYRILKVEWREEHEDVLLHEVLLCIKALCTTSPALHQLCKIGDDLFPTL:Sequence :HHHHHHHHHHHHHHHccGGGccTTHHHHHHHHHHHHHHHTccHHHHHHHHTcccccHHHH:Sec Str : XXXXXXXXXXXXX :SEG|382->394|eehedvllhevll :============================================================:RP:SCP|320->626|1z2cB1|2e-09|18.8|224/346|a.118.1.23 :============================================================:BL:SWS|320->599|RID1_SCHPO|8e-31|33.1|257/367 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|204->406|PF06371|3e-26|46.7|152/190|Drf_GBD 421: . . + . . .: 480 :LRMLFGEEKKGPSEFATRNIIISLLFSHLSSATFEEVATRARTILSYMHDPKPPKESAPL:Sequence :HHHTccTTcHHHHHHHHH HHHHHHHccccccHHHHHHHHHHHHTTccTTHHH:Sec Str : XXXXXXXXXXXX :SEG|440->451|iiisllfshlss :============================================================:RP:SCP|320->626|1z2cB1|2e-09|18.8|224/346|a.118.1.23 :============================================================:BL:SWS|320->599|RID1_SCHPO|8e-31|33.1|257/367 481: . * . . . .: 540 :PFIAEMHQARPYQLWCKEMSNVTKEVFWIFLHHFNVVPVAKAEDSSLPFIQRYFPPPHTP:Sequence :HHTTcTTccTTTHHHHHHHHHHHcccHHHHHH :Sec Str : XXXXXX:SEG|535->545|ppphtpvpaap :============================================================:RP:SCP|320->626|1z2cB1|2e-09|18.8|224/346|a.118.1.23 :============================================================:BL:SWS|320->599|RID1_SCHPO|8e-31|33.1|257/367 541: + . . . . *: 600 :VPAAPYIGGVEWDATNYLATHLDLINGLLASLPTIEERNELRTHLRASGLEKVMGRSLRT:Sequence : ccTTTHHHHHHHHHHHHTTcccHHHHHHHHHHHHTTcHHHH HTH:Sec Str :XXXXX :SEG|535->545|ppphtpvpaap :============================================================:RP:SCP|320->626|1z2cB1|2e-09|18.8|224/346|a.118.1.23 :=========================================================== :BL:SWS|320->599|RID1_SCHPO|8e-31|33.1|257/367 601: . . . . + .: 660 :CKEKLYPAVHEALKVWVSAAADDEWDYQFVREGPPRDAPPSTPRSPIKGCGSPKKLGIVG:Sequence :HHHcccHHHHHHHHHHHHHHHHHH :Sec Str :========================== :RP:SCP|320->626|1z2cB1|2e-09|18.8|224/346|a.118.1.23 661: . . . * . .: 720 :DAPPKIDFHVGISGNSNARNEQNRSQGLVNDGWI :Sequence : :Sec Str