[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01665"

            ""
            ""

OrgPattern -------------------------------------------------------------------- ----1--------------------------------------------------------2--1----11------------------------------------------------------------------11-----1-------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------1-------------------------------1------------------1---------------------------------------11----1-------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------- ------1-----111434344672225--111111111211111114411222244222233111111111-11111-1111111111-22533211111231223-----------------------------------------------------------------------------------3--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMLSILRALYAVPLVYSLVSGSEAKFALRQEETLEQWLETESSYALQSILDNIGDDGAKV:Sequence : HHHHHHTTcTTTcTTc:Sec Str : XXXXXXXXXXXXXX :SEG|30->43|qeetleqwletess : ================:RP:SCP|45->492|1agmA|2e-73|62.3|448/470|a.102.1.1 : =================:BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 61: . . . * . .: 120 :QGAHAGIVVASPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHEYITAQSYLQ:Sequence :TTccTTcccccccccccccccEEHHHHHHHHHHHHHHHHTTcGGGHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|45->492|1agmA|2e-73|62.3|448/470|a.102.1.1 :============================================================:BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|66->255|PF00723|5e-05|26.9|182/402|Glyco_hydro_15 121: . . + . . .: 180 :TVSNPSGTLSTGGLGEPKFHVDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDA:Sequence :HcccTTccTTTTGGGccEEcTTccccccccccccTHHHHHHHHHHHHHHHHHHHTTcHHH:Sec Str :============================================================:RP:SCP|45->492|1agmA|2e-73|62.3|448/470|a.102.1.1 :============================================================:BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|66->255|PF00723|5e-05|26.9|182/402|Glyco_hydro_15 181: . * . . . .: 240 :AKSIVWPVVQNDLSYVGQFWNSTGFDLWEEVQGSSFFTAIAQHRALAEGNNLARQLGTDC:Sequence :HHHTHHHHHHHHHHHHHHHTTccEEcTTcccEEEEHHHHHHHHHHHHHHHHHHHHTTccc:Sec Str : ########### :PROS|203->213|PS00820|GLUCOAMYLASE|PDOC00646| :============================================================:RP:SCP|45->492|1agmA|2e-73|62.3|448/470|a.102.1.1 :============================================================:BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|66->255|PF00723|5e-05|26.9|182/402|Glyco_hydro_15 241: + . . . . *: 300 :PHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLLGIIHNFDPEADCDDNTFQPC:Sequence :HHHHHHHHHHHHHHGGGccccccccEEccccccccTHHHHHHHTcccTTccccTTTTcTT:Sec Str :============================================================:RP:SCP|45->492|1agmA|2e-73|62.3|448/470|a.102.1.1 :============================================================:BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 :$$$$$$$$$$$$$$$ :RP:PFM|66->255|PF00723|5e-05|26.9|182/402|Glyco_hydro_15 301: . . . . + .: 360 :SSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGGQPWYLATFASAELLYD:Sequence :cHHHHHHHHHHHHTTTTTcGGGTTccTTccccccccTTccGGGccccHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|45->492|1agmA|2e-73|62.3|448/470|a.102.1.1 :============================================================:BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 361: . . . * . .: 420 :AIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEIIANVGSYADGYLNVARK:Sequence :HHHHHHHHTEEEEcTTTHHHHHHHcTTcccEEEETTcHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|45->492|1agmA|2e-73|62.3|448/470|a.102.1.1 :============================================================:BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 421: . . + . . .: 480 :YTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVPGSWGQKSAHDVPPTCL:Sequence :HccTTcccccEEcTTTccEEcccccHHHHHHHHHHHHHHTTcccccccGGGccccccccc:Sec Str :============================================================:RP:SCP|45->492|1agmA|2e-73|62.3|448/470|a.102.1.1 :============================================================:BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 481: . * . . . .: 540 :ATSAAGSYQTATITGWPSTLTPTPTPTNPAPCPTPSSVKITFQSVTDTKWGENIFLVGSI:Sequence :ccccccccccccccccccTTccccccccccccccccEEEEEEEEcccccTTEEEEEEEcc:Sec Str : XXXXXXXXXXXXXXXXXXXXXX :SEG|494->515|tgwpstltptptptnpapcptp :============ :RP:SCP|45->492|1agmA|2e-73|62.3|448/470|a.102.1.1 : ========================:RP:SCP|517->604|1a47A2|3e-25|29.9|87/105|b.3.1.1 :============================================================:BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|520->607|PF00686|9e-22|50.0|86/92|CBM_20 541: + . . . . *: 600 :PELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGKKFDYRYIRKSDDGRVVWESDPNRS:Sequence :GGGTTTccccccEEcEEccETTTTEEEEEEEEETTccEEEEEEEEETTccEEEccccEEE:Sec Str :============================================================:RP:SCP|517->604|1a47A2|3e-25|29.9|87/105|b.3.1.1 :============================================================:BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|520->607|PF00686|9e-22|50.0|86/92|CBM_20 601: . . . . + .: 660 :YTVPKNLEYQRRPSSSPAIQQRAKLPPH :Sequence :cccccc EEEEEETTEEEEccc :Sec Str :==== :RP:SCP|517->604|1a47A2|3e-25|29.9|87/105|b.3.1.1 :==== :BL:SWS|44->604|AMYG_ASPOR|0.0|54.3|558/612 :$$$$$$$ :RP:PFM|520->607|PF00686|9e-22|50.0|86/92|CBM_20