[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01672"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------11111111-1-111111111111111211111111111111111111------------------------11----1--1--------11-1---------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGRPTCPQKPPKRSILSRLHPNSWVMLHETDGFVRLPNERLIYTSPLRTTISLQALNPRP:Sequence : EEccccTTccccccTTccEEEE EEEEEEEEEEEEE:Sec Str : ======================================:RP:SCP|23->164|2cayA1|4e-09|21.7|115/130|b.55.1.12 61: . . . * . .: 120 :GDESLSLQSSNGRVHLTNQRIVYLPVQPTPQFQSFSAPLLNLHDTFVSAPFFGPNVWSAI:Sequence :TTEEcTTTcccEEEEEEccEEEEEEcc cHHHHcEEEEGGGEEEEEEEccccccccEEcE:Sec Str :============================================================:RP:SCP|23->164|2cayA1|4e-09|21.7|115/130|b.55.1.12 : ===================================================:BL:SWS|70->169|YEMB_SCHPO|7e-18|43.3|97/174 121: . . + . . .: 180 :VQPVVGGGIPPSNTAVQVKMTFKEGGAFDFHSAFERIKERLQQVVEQARENGMISERSSQ:Sequence :EEEcEccccccccTTccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcEEE :Sec Str :============================================ :RP:SCP|23->164|2cayA1|4e-09|21.7|115/130|b.55.1.12 :================================================= :BL:SWS|70->169|YEMB_SCHPO|7e-18|43.3|97/174 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|126->255|PF10349|1e-10|45.1|113/114|WWbp 181: . * . . . .: 240 :RDGAYSGVNFTNVHLDELPAYEGPSPTSSSFPPPFSGCSNPGNDLHSSQNTRHTPHEERF:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|204->223|psptsssfpppfsgcsnpgn :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|126->255|PF10349|1e-10|45.1|113/114|WWbp 241: + . . . . *: 300 :DPPTEPPPGYEEAQQQGVANDLEARLRRAQ :Sequence : :Sec Str :$$$$$$$$$$$$$$$ :RP:PFM|126->255|PF10349|1e-10|45.1|113/114|WWbp