[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01684"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------11112223333424333333333333333333322112223221212122122111111122211111122211----1-2----------222-----------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASIFRRGLEYLSPSASPAPSSVSDYEATSVPATGKPAVASKVITAQSPSTLFTVVDPTV:Sequence : XXXXXXXXXXXX :SEG|13->24|spsaspapssvs : ==================================:BL:SWS|27->368|APD1_YEAST|3e-18|33.1|275/316 61: . . . * . .: 120 :DGEDCDHDCASCTIKYPAKFSVDYEDELYGHVKGWATHVLVATGKTDWVRDVADEKGSVM:Sequence :============================================================:BL:SWS|27->368|APD1_YEAST|3e-18|33.1|275/316 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->375|PF06999|2e-58|61.4|220/222|Suc_Fer-like 121: . . + . . .: 180 :EAIERGGVSAKNGALKLSASNIPVPDEYYHHPEGEQPTTVLLLPAFTIIDHVTPALVPNL:Sequence :============================================================:BL:SWS|27->368|APD1_YEAST|3e-18|33.1|275/316 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->375|PF06999|2e-58|61.4|220/222|Suc_Fer-like 181: . * . . . .: 240 :IRQFVDLSPTTTTPLSDVMQIAGQEEPTEQTPSDINIPERPPLDLKDLSESLPTSLRSRP:Sequence :============================================================:BL:SWS|27->368|APD1_YEAST|3e-18|33.1|275/316 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->375|PF06999|2e-58|61.4|220/222|Suc_Fer-like 241: + . . . . *: 300 :CSHAAVILLCSQKTRDARCGQSAPLLRREFERHLRPLGLYRDLHDERPGGVGIYFISHVG:Sequence : ======================================================:RP:SCP|247->382|1f37A|2e-07|21.2|99/109|c.47.1.11 :============================================================:BL:SWS|27->368|APD1_YEAST|3e-18|33.1|275/316 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->375|PF06999|2e-58|61.4|220/222|Suc_Fer-like 301: . . . . + .: 360 :GHKYSANVIVYRRRNFEWFKEGKDDCSNNVESMEKEGASQGIWLARVRPEDCEGIVKFTV:Sequence :============================================================:RP:SCP|247->382|1f37A|2e-07|21.2|99/109|c.47.1.11 :============================================================:BL:SWS|27->368|APD1_YEAST|3e-18|33.1|275/316 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->375|PF06999|2e-58|61.4|220/222|Suc_Fer-like 361: . . . * . .: 420 :LQGKVVKPGLQLRGGFDREKGLISW :Sequence :====================== :RP:SCP|247->382|1f37A|2e-07|21.2|99/109|c.47.1.11 :======== :BL:SWS|27->368|APD1_YEAST|3e-18|33.1|275/316 :$$$$$$$$$$$$$$$ :RP:PFM|88->375|PF06999|2e-58|61.4|220/222|Suc_Fer-like