[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01743"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1111-11111--11111-111111111111111111111111-1111111-1---1-11-1--1------111----1------------------------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSRPSTTRPTLTPQFCFNQRALRDFLRISRSTIDDSITQNLNALVTPARKGFDPASTTAR:Sequence : XXXXXXXXXXXX :SEG|2->13|srpsttrptltp : =============================================:BL:SWS|16->182|CID2_SCHPO|6e-12|32.5|151/167 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->173|PF09774|9e-34|67.6|136/144|Cid2 61: . . . * . .: 120 :QTDFANKTQIDPENCEIFKNKVLFPSWQVRSDVLNYCAGVATSPDPEDPDLVLRQVESAK:Sequence :============================================================:BL:SWS|16->182|CID2_SCHPO|6e-12|32.5|151/167 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->173|PF09774|9e-34|67.6|136/144|Cid2 121: . . + . . .: 180 :DRERLVDERLDPYSARFFPREARTESLAMLIRNERGVETIIRSRTWGMVTERCGNSFEGW:Sequence :============================================================:BL:SWS|16->182|CID2_SCHPO|6e-12|32.5|151/167 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|16->173|PF09774|9e-34|67.6|136/144|Cid2 181: . * . . . .: 240 :EDALNRWREQQDQGK :Sequence :== :BL:SWS|16->182|CID2_SCHPO|6e-12|32.5|151/167