[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_01765"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------11111111-11111111111111111111--------1--------------------------------------------------------------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MANAVGMYSWSLRMPRHLAPTRSGVHRLACLSLYHALLSSCSRAFTSSKADEVRELIRTR:Sequence 61: . . . * . .: 120 :FRKDQKLQSISKIANALKAGQEALDLFQACSGGNKQSNQRVDSLLAATKSLLQQTLQERR:Sequence 121: . . + . . .: 180 :DQAANTPPPDRTSLAAKERANRRPEARRPHPERISILSRPRPVVSVNARGIPFLRIKKPQ:Sequence : XXXXXXXXXXXXXXXXXXX :SEG|135->153|aakeranrrpearrphper 181: . * . . . .: 240 :PPSLSCTIRSLLNRRWKRIERRDRLELELVRARDEDRWDALTGQSDILSWEGTVKESLHE:Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|198->217|rierrdrlelelvrardedr 241: + . . . . *: 300 :VNTIILEADRKNRAMAQRMWEIVLKERELAKKEALERRQKTPSEQQAKSE :Sequence : XXXXXXXXXXXXXXX :SEG|264->278|lkerelakkealerr