[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02107"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------11-1111111------------------------------------------------------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHNILKDALSYLSLYGALKNYCRRWKSTVKSHKLRHPLTLPPPESRPLPIYHRKKQQQQQ:Sequence : XXXXX:SEG|56->66|qqqqqqryqpq 61: . . . * . .: 120 :QRYQPQTESIFFTLPLEIRRQIYSYAFGGRAVKRPFLVRSVDWHAGGHQHSSHASQQQHV:Sequence :XXXXXX :SEG|56->66|qqqqqqryqpq : XXXXXXXXXXXXXXXX :SEG|104->119|hagghqhsshasqqqh 121: . . + . . .: 180 :PRRIQWADIIPIALLQTCRQIYTEAIEVFYSDAIFKAFTPVDMNRIFMGVPSQRLDSVRS:Sequence 181: . * . . . .: 240 :IWIDIRFAITCSLQCDGLEEVFDERTWAEVVRSFARFPRLRDVRVSFLKDDLTGGDYCAY:Sequence 241: + . . . . *: 300 :LLERFVLPSMAAMTDVPKYELMVNFEVESPENAPFRVRRIRAPMLY :Sequence