[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02114"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------111132211211111-111111111111111----2113--------------------------------------1------------------------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRERFAFTIRDEGEKRGRPDHDPDGLVLEAWAQGFMVGTLVFMAAITIANMRRRMLLHKL:Sequence : =================:BL:SWS|44->89|HLDE_RHOP2|8e-04|37.0|46/100 61: . . . * . .: 120 :ILAEDPPLGASFPYDFGISELLRNGPRFGIMLIAMCISIIFIIFDTLSVLRVLKGALPTG:Sequence : XXXXXXXXXXXXXXX :SEG|90->104|imliamcisiifiif :============================= :BL:SWS|44->89|HLDE_RHOP2|8e-04|37.0|46/100 121: . . + . . .: 180 :INPFWKLSFVFKCLCDAVVLDDFKTALDRLRDYWLAKNGVEVEGTERQSKSNAAATPVNR:Sequence 181: . * . . . .: 240 :SRFWRNSAGIIEPLELKRQQKDDTNCSSSGLSQENQVTPFGHL :Sequence