[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02123"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----1------11-111111111111111111-11-111111111111111111111111111-1111111-112212211111111-11111311-1-11-132---1212432------1-1-1224A1-11211--23-11-21221----1152-1------------------------1---1-1------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPLPSLKSSHQDQGSVNQSFLRPMSPNANPGPTESSNRRAKNLKNLSLRLPASPFRPPLS:Sequence : :Sec Str 61: . . . * . .: 120 :TAPIAESGRHLSEPSSPVRPHSRGSKRRPPNLTIQTPGFQRPYSSNGTRVVPPTPSVRPT:Sequence : :Sec Str : XXXXXXXXXXXXX:SEG|108->122|trvvpptpsvrptlr 121: . . + . . .: 180 :LRHIESSPSLNSILSPTHTNPMMPAPFPSKPFSLGTWCDADLGKASNQTNFNPNEPLIEF:Sequence : :Sec Str :XX :SEG|108->122|trvvpptpsvrptlr 181: . * . . . .: 240 :GEEDDCPISRESRKGSERGYPDGPIRIYDSGLWLYLEPNEEEASKFDVVFNVAKEVNNPF:Sequence : cccTTccEEEETTTEEccccccGGGGcccEEEEcccccTTcEE:Sec Str : =======================================================:BL:SWS|186->395|PMP1_SCHPO|9e-29|44.8|165/278 241: + . . . . *: 300 :STDGPKHDTVMSVWKATLAQSNAALRGEDPDTACSELSFKSALESLSDECPPTPKANRPE:Sequence :EEccccGGGHHHHHHHHHHTTccEEEEEcEEHHccccccccEEcETTccTTccccTTHHH:Sec Str : ===============:RP:SCP|286->396|1d5rA2|5e-12|13.5|111/174|c.45.1.1 :============================================================:BL:SWS|186->395|PMP1_SCHPO|9e-29|44.8|165/278 301: . . . . + .: 360 :PEYIHVPWDHNSEILDDLFPLCEIIDNRISKGKRVLIHCQLGVSRSASLVIAYGLYKNTH:Sequence :HTcEEEEcccccTTccTHHHHHHHHHHHHcTTccEEEEcccccHHHHHHHHHHHHHHHcc:Sec Str : ########### :PROS|337->347|PS00383|TYR_PHOSPHATASE_1|PDOC00323| :============================================================:RP:SCP|286->396|1d5rA2|5e-12|13.5|111/174|c.45.1.1 :============================================================:BL:SWS|186->395|PMP1_SCHPO|9e-29|44.8|165/278 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|302->391|PF00782|6e-18|48.3|89/125|DSPc 361: . . . * . .: 420 :LDFNAVYGMVKERSCWVGPNMSLIYQLTDFRTKIRGGTITRSPADYNEAMRTAQSSHTQT:Sequence :ccHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHTTTTccTTcccH:Sec Str :==================================== :RP:SCP|286->396|1d5rA2|5e-12|13.5|111/174|c.45.1.1 :=================================== :BL:SWS|186->395|PMP1_SCHPO|9e-29|44.8|165/278 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|302->391|PF00782|6e-18|48.3|89/125|DSPc 421: . . + . . .: 480 :TDIEREIAHSKAAASTPNNGKPVVDPSKLFTQVNPFSPDTSSNRVRRHITPRPLPLREKF:Sequence :HHHHHHcccccc :Sec Str 481: . * . . . .: 540 :HTIHSLRNSPCHDGPTATTATTTTTTTTTTTFQRPSVRSALQMDLVMQDVPPSPSFFSPK:Sequence : :Sec Str : XXXXXXXXXXXXXXXX :SEG|496->511|tattattttttttttt : XXXXXXXXX :SEG|531->539|ppspsffsp 541: + . . . . *: 600 :ASEFIAAPFPRSKAGDITFEKFANLQSPNLVRRPSMNDPRSPQRRAEPIIMRSIDEFL :Sequence : :Sec Str