[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02166"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------11-2--------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MATPIEYIWKVARPKNETIARALMYAAYQTAIQTDPNTTRVLIRSYIHPSTRTNGAWVKD:Sequence 61: . . . * . .: 120 :KPHITVSVKNPQTSQAGQHQTSHGYTPHIKSFDVIRVSPNSNIANDSSSLAWPASMETND:Sequence 121: . . + . . .: 180 :KDTFTGPPLLLGPKGQFFTWPSEETGE :Sequence