[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02183"

            ""
            ""

OrgPattern -------------------------------------------------------------------- -------------------------1------------11--1---------1-1-----------11-----------------------------------------------------------------------------1--------------------------1--------------------------------------------1---1---------------------------------------------------------------------------------------------------------1---112------------------------------------------1-----------------------------------------1--------------1--------------------------------------------------------------------------------------------------1------------------------------------------------------------1-----1------------------------------------------1111-----------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------111-11--1---------------------------------------------------------------------------------------- ----2---------153D9CBE6IEIC3333345443222222211C97DBAGF778E8444---------------------------5343C13------2-----21------------------------------------------------------3-----------12-------3---F-N-----2- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASQAEFVTPSAVNATMKASAVVGHRQRCSYGDSCWPTEGEWQSFNASVSGHLIRTYPSA:Sequence : EEEcHHHHccTTcccHHHHHTTcccccccHHHHHHHHHHHHHcccccHHHHHccccc:Sec Str 61: . . . * . .: 120 :AVCHAERYDDAKCTAAKENWLDSFWRTNQTGAYSAILWELGENGQCFIDSPRDAPCDQGI:Sequence :ccTTccHHHHHHHHHHHHHHcGGGEEEccccccccGccccccccccccccTccccTTccc:Sec Str : ==:RP:SCP|119->302|1w1oA2|4e-22|19.2|177/206|d.145.1.1 121: . . + . . .: 180 :VPHYSVNIQSTSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWH:Sequence :cccEEEEcccHHHHHHHHHHHHHHTccEEEEcccccTTcTTcccccEEEEcTTcccEEEE:Sec Str :============================================================:RP:SCP|119->302|1w1oA2|4e-22|19.2|177/206|d.145.1.1 181: . * . . . .: 240 :TSFIPKGAPQETTGIPAVTLQAGEQWLDVYRAAAENGVIVVGGSARTVGAAGGYLTGGGH:Sequence :TTTEEcTTTTTTETETEEEEETTccHHHHHHHHHTTTEEEcccccTTccHHHHHTTcccc:Sec Str : XXXXXXXXXXX :SEG|229->239|gaaggyltggg :============================================================:RP:SCP|119->302|1w1oA2|4e-22|19.2|177/206|d.145.1.1 241: + . . . . *: 300 :SPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYALRGGGGSAWGVITSVTYKTH:Sequence :cTTHHHHccGGGGEEEEEEEcTTccEEEEEccccHHHHHHHHHHGGGcTcEEEEEEEEEE:Sec Str :============================================================:RP:SCP|119->302|1w1oA2|4e-22|19.2|177/206|d.145.1.1 : =========================================================:BL:SWS|244->553|YVDP_BACSU|1e-07|23.1|290/447 301: . . . . + .: 360 :PSPSHIQVGLVQFNVTNNSTLRAVIEKCLQELPSITDAGYTGYGSMNFLSGGKEPLGFGA:Sequence :EccccEEEEEEEEcEccHHHHHHHHHHHHHHHHHTTTTTTcccEEEEEEcTTccEHHEEE:Sec Str :== :RP:SCP|119->302|1w1oA2|4e-22|19.2|177/206|d.145.1.1 :============================================================:BL:SWS|244->553|YVDP_BACSU|1e-07|23.1|290/447 361: . . . * . .: 420 :IFIQPNGTNATFTRTFKPYYDIAKMQGVSGALANIDFPSWIEYAEVFVQDPNIATNIIDG:Sequence :EEEEccccHHHHHHHHHHHHTTccccEEccEEEcHHHHHHHHHHcccccccEEEEEEEEE:Sec Str :============================================================:BL:SWS|244->553|YVDP_BACSU|1e-07|23.1|290/447 421: . . + . . .: 480 :SRLLTSQALLHRTRDLVDLMFEYASFGPGFNFIGKVSSAKRDETSTHPIWEQSRALLSFA:Sequence :cccHHHHHHHHHHHTTGGGcEEETTTTEEEEEEEEcTGcccccTTccccccccccEEEEE:Sec Str : ======================:RP:SCP|459->553|1h12A|3e-08|8.4|95/404|a.102.1.2 :============================================================:BL:SWS|244->553|YVDP_BACSU|1e-07|23.1|290/447 481: . * . . . .: 540 :ANWRDDASANEKRNAKLSLVEISKKLGDIVGPGGGTYVNEANPYEPDWQNVFWGEKYARL:Sequence :EEEcTTcTTTTHHHHHHHHHHHHHHHTTcEEEEEccGGGcccccHHHHHHHHcHHHHHHH:Sec Str :============================================================:RP:SCP|459->553|1h12A|3e-08|8.4|95/404|a.102.1.2 :============================================================:BL:SWS|244->553|YVDP_BACSU|1e-07|23.1|290/447 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|517->553|PF08031|9e-06|43.2|37/45|BBE 541: + . . . . *: 600 :LAIKKRIDPTNLFVCNRCVGTDIVLEP :Sequence :HHHHHHHcTTcccccTTccccc :Sec Str :============= :RP:SCP|459->553|1h12A|3e-08|8.4|95/404|a.102.1.2 :============= :BL:SWS|244->553|YVDP_BACSU|1e-07|23.1|290/447 :$$$$$$$$$$$$$ :RP:PFM|517->553|PF08031|9e-06|43.2|37/45|BBE