[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02189"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1-111111111111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAPHHRRRLPASRRRIEDEGEEDGSVAGDFEDDSLSEASSHQDEDPEGEGSDFSDNDFPA:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|2->15|aphhrrrlpasrrr : XXXXXXXX :SEG|17->24|edegeedg 61: . . . * . .: 120 :SPESRKDERVESRTQKEANCSSPTKTPFAAKVSETEAMLNGMKLADDTAGVAEIHFDDMA:Sequence : :Sec Str : ==========================:BL:SWS|95->266|CASC3_DANRE|4e-05|27.2|169/100 121: . . + . . .: 180 :SEHDASPDLSDKATRLPQSQRRRREQTENGKERGANPAFVPTRGGFFLHDKRSSNSPNGY:Sequence : EEGGGTcTTcEEEEE:Sec Str :============================================================:BL:SWS|95->266|CASC3_DANRE|4e-05|27.2|169/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|121->230|PF09405|5e-11|39.2|102/122|Btz 181: . * . . . .: 240 :RTANNKLKSKPHGLIVDSNVRRPPPKPDITDGPWTHDLHESVNEGPPPASSRPSSTLPSN:Sequence :EEccccTTcGGGGcTTHHHHHHccccccccEETTcccccccEETTEEEEEccHHHHHHHH:Sec Str :============================================================:BL:SWS|95->266|CASC3_DANRE|4e-05|27.2|169/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|121->230|PF09405|5e-11|39.2|102/122|Btz 241: + . . . . *: 300 :MPSGQSSKPVPTAPRSTPPNRSFSSTVLIGNVPVVVFLPGMANPIPYSAVPKKQHTRLPQ:Sequence :HHHHcccEEcHHHHHHHHHHcHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHH:Sec Str :========================== :BL:SWS|95->266|CASC3_DANRE|4e-05|27.2|169/100 301: . . . . + .: 360 :HRPPLRRDKPVRIALPGSPPRYIFPSTERSFIFIPRALRPNQQAYRGRGRGGFYSSRRSS:Sequence :HHHHHHHHHHccccGGGccEEccEEEcTTccE :Sec Str : XXXXXXXXXXXXXXXX:SEG|345->364|yrgrgrggfyssrrsslygg 361: . . . * . .: 420 :LYGGTVYTPSLPMSRRSSVGRVASRNGMISPGGSVMSRPPIMAGEAGKPVVRLPPVGRGP:Sequence : :Sec Str :XXXX :SEG|345->364|yrgrgrggfyssrrsslygg : XXXXXXXXXXXX :SEG|374->385|srrssvgrvasr : XXXXXXXXXXXX:SEG|409->445|pvvrlppvgrgplpagpmapppappsvasaagavpqp 421: . . + . . .: 480 :LPAGPMAPPPAPPSVASAAGAVPQPLAQPSPYTPQHPQFRENRPTPTIPMHQPRPQKTVS:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXXXXX :SEG|409->445|pvvrlppvgrgplpagpmapppappsvasaagavpqp 481: . * . . . .: 540 :VADIESPMSLYNPPQQLEQPFHHQVPMALNGPPYGPETAGYSSHTRNVSHPPQASATPLS:Sequence : :Sec Str 541: + . . . . *: 600 :QIPERAIHAPPFQPYPYQQPQNYYPSASYPSGPVGYPGPNPDYPQYSAPVPPGPTPVFVP:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|550->581|ppfqpypyqqpqnyypsasypsgpvgypgpnp : XXXXXXXXXXXX:SEG|589->600|pvppgptpvfvp 601: . . . . + .: 660 :AGQQAPYGMPSQPTTEQFTQSGTVAHESNGTVYYYDASQYPNYPNATYPVAPQGGVVGMG:Sequence : :Sec Str 661: . . . * . .: 720 :GMITPPGTYYYPQQPNGTVYYS :Sequence : :Sec Str : XXXXXXXXXXXX :SEG|664->675|tppgtyyypqqp