[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02193"

            ""
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------11---------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ---------------1--11-11-11-1111-111111-1111--------------------------------------------------------------------------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRLCSRQLCVSCAIYAESSTPYACHAGLTAPIYAPSFHIHPVRSPRDIATATSLIKSYTD:Sequence : :Sec Str : ======================:BL:SWS|39->209|YHM7_SCHPO|3e-12|39.7|131/163 61: . . . * . .: 120 :SLGIDLSYQDFSTEISQMPGKYAPEKGGEILLAIQNNSTSDNFYEPVHAEESHGGSVSPR:Sequence : HHHHHHHTTcTTEEcccHHHHHHHHHcccccc:Sec Str :============================================================:BL:SWS|39->209|YHM7_SCHPO|3e-12|39.7|131/163 121: . . + . . .: 180 :KNYCCSCTYVESDVLGCAALRNLPSINPLRICEIKRLYILPRARSLGYRQGAYQMQLSTR:Sequence :EGEEcTTcccTTcEEEEEEEEEcEccccTTEEEEEEEEEcGGGTccTccHHHHHHHHHTc:Sec Str : ===========================================================:RP:SCP|122->209|1on0A|8e-10|22.1|86/156|d.108.1.1 :============================================================:BL:SWS|39->209|YHM7_SCHPO|3e-12|39.7|131/163 181: . * . . . .: 240 :PGRKGYAEMRLDTLPTMHSAIALYKSLGF :Sequence :GGGTTccEEEEEccTTHHHHHHHHHHTTc :Sec Str :============================= :RP:SCP|122->209|1on0A|8e-10|22.1|86/156|d.108.1.1 :============================= :BL:SWS|39->209|YHM7_SCHPO|3e-12|39.7|131/163