[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02517"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1111221-31112222222222222222222222222222222222322222222222222222222221222222222222222222-2222227222222222212212121112111111122141EE4-622-11121111111--11131211111-11111311-11111111C11-1121232111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASLPLPSSTSHKPTASLDLSKKLSSLRTNRRNPSALSSQAAAPPTPQLPDRPTLTQHQF:Sequence : c:Sec Str : XXXXXXXXXXX :SEG|17->27|sldlskklssl : XXXXXXXXXXXXXXXXX :SEG|34->50|psalssqaaapptpqlp : ===:BL:SWS|58->424|PTPA2_ASPFU|e-147|66.9|366/422 61: . . . * . .: 120 :IRPVPRILSPQDLETFLSSPAHSLIIAFVFNVSDSVRQQSVSSLVQLPVSETIRKVLSIL:Sequence :cccccccccTTTTHHHHccHHHHHHHHHHHHHHHTTTTccTTccccccc HHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|92->110|vsdsvrqqsvsslvqlpvs : ==========================================================:RP:SCP|63->357|2ixnA1|e-100|43.4|290/292|a.268.1.1 :============================================================:BL:SWS|58->424|PTPA2_ASPFU|e-147|66.9|366/422 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->357|PF03095|2e-78|48.3|290/296|PTPA 121: . . + . . .: 180 :SAIEELIDKHPSLDQNGSRFGNPAFRDLFDDIAAHSVQWHKDILGLDDPAAIEEVSTYLI:Sequence :HHHHHHHTTcccccccccccccTHHHHHHHHHHHHHHHHHHHHHHHHcTTcHHHHHHHHH:Sec Str :============================================================:RP:SCP|63->357|2ixnA1|e-100|43.4|290/292|a.268.1.1 :============================================================:BL:SWS|58->424|PTPA2_ASPFU|e-147|66.9|366/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->357|PF03095|2e-78|48.3|290/296|PTPA 181: . * . . . .: 240 :HSLGSRSRLDFGSGHELNFMMWLLCLYLFGMLDRNDFPVIVCHVFIRYMKLMRHVQTTYY:Sequence :TccccTTTTEEcHHHHHHHHHHHHHHHHTTcccHHHHHHHHHTHHHHHHHHHHHHHHHHT:Sec Str :============================================================:RP:SCP|63->357|2ixnA1|e-100|43.4|290/292|a.268.1.1 :============================================================:BL:SWS|58->424|PTPA2_ASPFU|e-147|66.9|366/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->357|PF03095|2e-78|48.3|290/296|PTPA 241: + . . . . *: 300 :LEPAGSHGVWGLDDYHFIPFLFGAAQLTGHPYITPLAIHNNVVLDEEGDNWIYLDQVRWV:Sequence :cEEccccccccccccccHHHHHHHHHTTTcccccGGGGGcHHHHHHHTTTcHHHHHHHHH:Sec Str :============================================================:RP:SCP|63->357|2ixnA1|e-100|43.4|290/292|a.268.1.1 :============================================================:BL:SWS|58->424|PTPA2_ASPFU|e-147|66.9|366/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->357|PF03095|2e-78|48.3|290/296|PTPA 301: . . . . + .: 360 :DSVKTVKGLRWHSPMLDDISGAKNWYKVEAGMKKMFVKEVLGKLPIMQHFLFGSLIPALP:Sequence :HHHTTTccHHHHcHHHHHHTTcccHHHHHHHHHHHHHHHTTTcHHHHTTccccccccccc:Sec Str :========================================================= :RP:SCP|63->357|2ixnA1|e-100|43.4|290/292|a.268.1.1 :============================================================:BL:SWS|58->424|PTPA2_ASPFU|e-147|66.9|366/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|63->357|PF03095|2e-78|48.3|290/296|PTPA 361: . . . * . .: 420 :EMGERNEKAEQPDPGSGHPHGHAHSHQNDFWGDCCGIKVPSAVAAGEEMRKRQGGTGLRP:Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|374->386|pgsghphghahsh :============================================================:BL:SWS|58->424|PTPA2_ASPFU|e-147|66.9|366/422 421: . . + . . .: 480 :IPFD :Sequence : :Sec Str :==== :BL:SWS|58->424|PTPA2_ASPFU|e-147|66.9|366/422