[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02551"

            ""
            ""

OrgPattern 111111111111111111--11-122212222111111---------1113221-------1-11--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1211111131111111111111111111111111111111111111211111111111111111111111111111111111111111-12111111111121111111111212221133-41A2-11482-425112111111111111-121211113112111211121311111I2111142441311112111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPKNKGKGGKNRRRGKNENDNEKRELTFKEEGQEYAQVVKMLGNGRLEALCFDGEKRLAH:Sequence : ccccccccEEEEEEEcccccEEEEEcTTccEEEEE:Sec Str : XXXXXXXXXXXXXXXXXXXXXXX :SEG|3->25|knkgkggknrrrgknendnekre : ####################:PROS|41->63|PS01262|IF1A|PDOC00970| : ===================================:RP:SCP|26->111|1jt8A|1e-26|33.7|86/102|b.40.4.5 : ===================================:BL:SWS|26->135|IF1A_SCHPO|2e-47|80.9|110/138 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|37->94|PF01176|4e-06|37.9|58/66|eIF-1a 61: . . . * . .: 120 :IRGKLRKKVWINQGDIILLSLRDYQDEKGDVILKYSADEARSLKAYGELPESAKINETDT:Sequence :ccTTcccccccccccEEEEEccccccccEEEEEEccHHHHHHHHHHTcccHHHHHHTTcc:Sec Str :### :PROS|41->63|PS01262|IF1A|PDOC00970| :=================================================== :RP:SCP|26->111|1jt8A|1e-26|33.7|86/102|b.40.4.5 :============================================================:BL:SWS|26->135|IF1A_SCHPO|2e-47|80.9|110/138 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|37->94|PF01176|4e-06|37.9|58/66|eIF-1a 121: . . + . . .: 180 :YGHEGLDDNVEFDEDRESADEKDIDIDEI :Sequence :ccccccccccccccccc cccccc :Sec Str :=============== :BL:SWS|26->135|IF1A_SCHPO|2e-47|80.9|110/138