[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02563"

            ""
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------- ---1----------1112---1222-222363344432111221111322223112112---1----------------------------11----1-----12-----------------------------------------------------------------------11--------131217------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MALNMEAENRTFPDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLF:Sequence : EEEEEETTHHHEEEEEccccEEEEEEEcccTcccccTTcccGGGccEEcccTTccc:Sec Str : ========================================================:RP:SCP|5->285|1fj2A|7e-32|26.1|222/229|c.69.1.14 : ============================================:BL:SWS|17->188|APTH1_SCHPO|1e-12|35.1|151/224 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->259|PF02230|2e-22|46.0|174/206|Abhydrolase_2 61: . . . * . .: 120 :PSWRWVFPSSGSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREI:Sequence :ccccccccHHHHHHHHHccEEEEEccTTcccccHHHHGGGTTcTTcHHHHHHHHHHHHTH:Sec Str :============================================================:RP:SCP|5->285|1fj2A|7e-32|26.1|222/229|c.69.1.14 :============================================================:BL:SWS|17->188|APTH1_SCHPO|1e-12|35.1|151/224 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->259|PF02230|2e-22|46.0|174/206|Abhydrolase_2 121: . . + . . .: 180 :ELLGGRSDNIIFGGLSQGMATALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLY:Sequence :HHHTEEEEEEEEEEETHHHHHHHHHHHTcTTEEEEEEEEEEETHHHHHHHHHHHHcTTTc:Sec Str :============================================================:RP:SCP|5->285|1fj2A|7e-32|26.1|222/229|c.69.1.14 :============================================================:BL:SWS|17->188|APTH1_SCHPO|1e-12|35.1|151/224 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->259|PF02230|2e-22|46.0|174/206|Abhydrolase_2 181: . * . . . .: 240 :RSKYASELGTSMCLIMPAFLLGTTGCPPFDSKPEEVKAVLSTPVLLLHGTDDAVVDISLG:Sequence :cEEEEEcccccGGGccHHHHHHHHccTTTcHHGGGGGGGcccEEEEEEETTcccccTHHH:Sec Str :============================================================:RP:SCP|5->285|1fj2A|7e-32|26.1|222/229|c.69.1.14 :======== :BL:SWS|17->188|APTH1_SCHPO|1e-12|35.1|151/224 : ==============================:BL:SWS|211->273|DPP5_TRISH|2e-04|35.6|59/726 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->259|PF02230|2e-22|46.0|174/206|Abhydrolase_2 241: + . . . . *: 300 :QQACQLLKEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAAFLESKTS :Sequence :HHHHHHHHHHTcccEEEEETTccccccTTHHHHHHHHHHHHHHHc :Sec Str :============================================= :RP:SCP|5->285|1fj2A|7e-32|26.1|222/229|c.69.1.14 :================================= :BL:SWS|211->273|DPP5_TRISH|2e-04|35.6|59/726 :$$$$$$$$$$$$$$$$$$$ :RP:PFM|23->259|PF02230|2e-22|46.0|174/206|Abhydrolase_2