[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02577"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------112113------------------------------------------------------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVKKLHLNEERQDKGDRELIQQLNCYERRLRAWRLENQQQQQDIRAYFLILQGAELIQIS:Sequence : ===================================================:BL:SWS|10->131|ATG1_ASPFU|3e-04|27.7|119/973 61: . . . * . .: 120 :SERVGISITLSGTVSMEYASALSSFSQKFVIEKPGVSPSTTQNTLRCELQTRSGYHRKDS:Sequence :============================================================:BL:SWS|10->131|ATG1_ASPFU|3e-04|27.7|119/973 121: . . + . . .: 180 :VHGHNVSIERKAAEPSSFERRGNGDQTFPCDAGARIFIFREQCVYVGRTALAISS :Sequence :=========== :BL:SWS|10->131|ATG1_ASPFU|3e-04|27.7|119/973