[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02593"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1-23111112121111113112333333---2557431211131111-------------------------------------------------------------------------------------------------------------------------------2--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEALSQPTGSVKSVVVEEPPLKPPFSREAVPSDLAVLSEVMSSLPTISRTRLHDAFLTET:Sequence : EEEEEEcccccccHHHHHTcccccccHH:Sec Str 61: . . . * . .: 120 :DVASYLQRDLDLSRLNRIHNILWMAGRPINARPLHRQRMMGLEIIPTEQSDLHLLKFSNH:Sequence :HHHHHHHHHHHHHHHHHHTTEEcccccGGGE EEccc ccccEEEcccTTc:Sec Str 121: . . + . . .: 180 :LLVKPLPSYLLNHDFWTKHLCSSKELHESASGLLVSYIWLICSPIDLKVAQDHQLLPSNL:Sequence :EEccTTcEEEE EEccGGGccHHHHTHHHHHHHHHHHHHHHcccTTccccHHHHHHHH:Sec Str 181: . * . . . .: 240 :AWTWWKSFVDDVFKHININALDTVNKRYHFGELRLNRINSIYRVRFFFTHFIRGYLYGYN:Sequence :HHTcc cccHHHHTTccHHHHHHHHT :Sec Str 241: + . . . . *: 300 :RYTVFFERNFGWILVVFVYFSLVLSAMQVAMDVPGLQDNTDFVNATYGFVIFSIVIVAFF:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|254->265|lvvfvyfslvls : XXXXXXXXXXXX:SEG|289->300|fvifsivivaff 301: . . . . + .: 360 :LGLVALIFTSIFLYNMGAAISDDREKRLRREKLSRERII :Sequence : :Sec Str : XXXXXXXXXXXXXXXXX :SEG|321->337|sddrekrlrreklsrer