[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02908"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------111111111111-1111111111111111111-11-1111--1111------------------------------1------------------------------------------------------------------------------------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDCTPSARTTRPVAAGPSQTTAAVIRFSCLFTYDIKRKAKRWQDGFLRFHTFNRRVMVYG:Sequence : :Sec Str : =========================================:BL:SWS|20->81|YJB1_SCHPO|2e-07|33.9|62/715 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|27->82|PF10382|8e-12|42.9|56/79|DUF2439 61: . . . * . .: 120 :TSGDFVGDLHMRESSTVRDGDQLELERGVLVEVGECLEKTETDLTELLEKRKTNSTASPA:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|83->113|lelergvlvevgeclektetdltellekrkt :===================== :BL:SWS|20->81|YJB1_SCHPO|2e-07|33.9|62/715 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|27->82|PF10382|8e-12|42.9|56/79|DUF2439 121: . . + . . .: 180 :RTMIQQTPAAAAAAAGVVANPARPKSLNELLGKNRGPLGRAVLPRKSPFQLQRENDQDQH:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|128->142|paaaaaaagvvanpa 181: . * . . . .: 240 :DHAAERPTKRRKLSPVVERQREGDASIASKNLERISARKINDGGSTGINLASTTKPNQND:Sequence : :Sec Str : ==============================================:BL:SWS|195->324|K1109_HUMAN|2e-04|37.3|110/5005 241: + . . . . *: 300 :TSGGFQPASALKITSSSRAEHGRKGSKKALLGNQKAITAMFHGDKRNITFPSPVENPRKK:Sequence : :Sec Str :============================================================:BL:SWS|195->324|K1109_HUMAN|2e-04|37.3|110/5005 301: . . . . + .: 360 :LMCLEISKKPKTGKKPAQRESTGSSWNTSIPGGGIEPSSSSSVTPLGGLSRSEGEKMAVL:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXX :SEG|328->350|tsipgggiepsssssvtplggls :======================== :BL:SWS|195->324|K1109_HUMAN|2e-04|37.3|110/5005 : =====:BL:SWS|356->462|INP52_YEAST|7e-04|28.3|99/100 361: . . . * . .: 420 :TPTGGNSPMDYIPSTSTMRVLEESFHVSEAPPSPQKATRSISDFFKPNPPPPAIQEEKEN:Sequence : HHHHTcccH HHHHHHTcccccccccc EEc:Sec Str :============================================================:BL:SWS|356->462|INP52_YEAST|7e-04|28.3|99/100 421: . . + . . .: 480 :TGSSPKPPSLLRSHSDIEALAQPTESTTLLSNPAPPHRHRTAANGLQKSLSDTSALRCRS:Sequence :ccccTTTTccccccHHHHHHHH HHHHccccccccTT :Sec Str : XXXX:SEG|477->486|rcrssrpsrs :========================================== :BL:SWS|356->462|INP52_YEAST|7e-04|28.3|99/100 481: . * . . . .: 540 :SRPSRSLQTRLMTVSGSCTPDSSRNDEEQGPWTSEALDLFDWWPPNRPKPGERGQEL :Sequence : :Sec Str :XXXXXX :SEG|477->486|rcrssrpsrs