[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02917"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------112222222222221222221222222322222222212222222222111111-1111--11-1111-111-1-11121111111-11435-------------------------------1-------------------------------------------1-------2--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MADSLPMYAAGAVGDNGVDLDDPFISSTPAGNHTQRELHRYSSFDAQLFTLNTSSPAQAK:Sequence : :Sec Str : =====================================:RP:SCP|24->142|2pggA1|7e-04|15.1|119/765|e.8.1.4 : =========================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 61: . . . * . .: 120 :RALEAHLAETERRLEETSNLGTALIEQQRELMDKLKEVEQQHTDGEIGPDLRRKLNDLER:Sequence : :Sec Str :============================================================:RP:SCP|24->142|2pggA1|7e-04|15.1|119/765|e.8.1.4 :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->357|PF01576|7e-05|26.1|264/794|Myosin_tail_1 121: . . + . . .: 180 :EYNEIGRETARVALGPKVRLTGQEDGLATPSLDSRHHASPSVFSSQATNSPSKVTVPSRK:Sequence : :Sec Str :====================== :RP:SCP|24->142|2pggA1|7e-04|15.1|119/765|e.8.1.4 :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->357|PF01576|7e-05|26.1|264/794|Myosin_tail_1 181: . * . . . .: 240 :QRNQPSSRVHDIEFATEISTSLLAQVRQLQALLAEREEAIKALTLEKSHLELEAEGFTQR:Sequence : HHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|202->214|llaqvrqlqalla : ############## :PROS|219->232|PS01192|HMG_COA_REDUCTASE_3|PDOC00064| :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->357|PF01576|7e-05|26.1|264/794|Myosin_tail_1 241: + . . . . *: 300 :LRALDESEQRYKDENWSLETQTHDLLAAAKEASDRESRLTSNLNALTVEKNNIQRELDEL:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|63->357|PF01576|7e-05|26.1|264/794|Myosin_tail_1 301: . . . . + .: 360 :KQANGRLVEENMATQKALDSELHILRRNITLGESERNALQQKVDELAGQNQELAKAVAAK:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH :Sec Str :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|63->357|PF01576|7e-05|26.1|264/794|Myosin_tail_1 361: . . . * . .: 420 :LRQHEADSAKDPNPEDNRKASDDLTPENSPPPSPNKPTPRHGLLESETLKSSLHHAHRMI:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|385->399|tpenspppspnkptp :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 421: . . + . . .: 480 :QTLKGTIHREKTEKIELKRMLQDARDELEQRRAEPVRPISSHNRRQKPKGDNFKKPARPE:Sequence : :Sec Str :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 481: . * . . . .: 540 :MLGAGRKGITQIEVAEPEWEDEGEPSPTRVARPNKRAVSYGNSGIESSTTSDAYQTANET:Sequence : :Sec Str : XXXXX:SEG|536->550|taneteafetanere :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 541: + . . . . *: 600 :EAFETANEREVTTESEAFQTGTENFIDESSDDLTETESRTMHTGTIRPRRSGQLNSTRPM:Sequence : :Sec Str :XXXXXXXXXX :SEG|536->550|taneteafetanere :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 601: . . . . + .: 660 :SFASTASTSGDEDEYIEVRTPVQHQPPRYRIKMSRGRRGRVSQESHIRQGSVPLSPRDSP:Sequence : :Sec Str :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 661: . . . * . .: 720 :ASLNSPPQSPRQREISGGQSLFAELSGLAGAGSDSEFGAPLRSSTMSEMSTPSRRQSFAT:Sequence : :Sec Str :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 721: . . + . . .: 780 :LADSSRPVTAREIVMVDSCTMTEPLPPAVPAQFEIVSPPESTSDYKDAETSTAPREGVDA:Sequence : :Sec Str :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 781: . * . . . .: 840 :FTTFERIVVIDSATQCMPIETPLLAKSEPAVTIDIAPEIPDTDANHESLHATIETLPSPV:Sequence : :Sec Str :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 841: + . . . . *: 900 :MLPMEPTILDISPIYSEQTAPISPMPIDLQSRRPSVRMDMSVIAFEDSRPSLPAVTPSKS:Sequence : :Sec Str :======================== :BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 901: . . . . + .: 960 :SLDLAMSSIQSTSTNPLAVPVSLPESKRAQVLEFSTIFEVGTSPKEAIFPTVPPMTLEVS:Sequence : :Sec Str : ===================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 961: . . . * . .:1020 :NIQCVESLPVKPVPTILSVEPPTDTLKLNGIEAQPCPPQVTDRATQSQISTMDRGISTSP:Sequence : :Sec Str :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 1021: . . + . . .:1080 :LPKIETESQGSQTALTEVLETGERSSQVQISTAEISSQTILTGFQIDKLLMERQASRPVT:Sequence : :Sec Str : X:SEG|1080->1097|taiessqaqaaiistqss :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 1081: . * . . . .:1140 :AIESSQAQAAIISTQSSPLTTPKAKQLSSAQTGLLHPNNATRRPGSSGSQRLGNSLSVPP:Sequence : :Sec Str :XXXXXXXXXXXXXXXXX :SEG|1080->1097|taiessqaqaaiistqss :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 1141: + . . . . *:1200 :LPVDHKQTIAAASQRLSSEASPSVMGPPIAPASSYRSSSQIRPRTPSEQPSRNSARNQST:Sequence : :Sec Str :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 1201: . . . . + .:1260 :PQTKFRRTSTSMASRRSSISSFASELDERFNIAKATYPFESGADPRMIQAITQTMIGEFL:Sequence : ccccEEEEE:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|1205->1224|frrtstsmasrrssissfas : =================:RP:SCP|1244->1360|1v5pA|3e-06|17.0|112/126|b.55.1.1 :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 1261: . . . * . .:1320 :WKYTRKLGRSDMSNTRHQRYFWVNPYTRTLYWGPHDPQVLAKSQQRSKSVAIEAVRVVND:Sequence :EEEcccccTTccccEEEEEEEEEcccEEEEEEEETTTTEEEEEEEEEEGGGEEEEEEccc:Sec Str :============================================================:RP:SCP|1244->1360|1v5pA|3e-06|17.0|112/126|b.55.1.1 :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 1321: . . + . . .:1380 :DNPYPPGLHRKSLEIITPGRTLKFTAATSQRHETWFNALSYLLLRTADDETEEQDVVWEA:Sequence :cccccGGGcccTHEEEETTEEEEEEEccHHHHHHHHHHHHHHHTTccccccccccccccT:Sec Str :======================================== :RP:SCP|1244->1360|1v5pA|3e-06|17.0|112/126|b.55.1.1 :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 1381: . * . . . .:1440 :GSDYNATNGRNSRQAESRRSISSHNSRAARTISKQFVETVPTLRRPVTPNQPSPSPSSRP:Sequence :TcTTEETTTccccTTccccEEccc :Sec Str : XXXXXXXXXXXXXXXX:SEG|1425->1446|rpvtpnqpspspssrpgsslrp :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 1441: + . . . . *:1500 :GSSLRPDQTRPGSVTRISNVFRSSGIKSTFSSRRSRYGNASGSIDSTSAASNDSAEELRR:Sequence : :Sec Str :XXXXXX :SEG|1425->1446|rpvtpnqpspspssrpgsslrp :============================================================:BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676 1501: . . . . + .:1560 :VIERQDREADRLENVRACCDGKHDVSALSRTSRYSARISPLSHHVHS :Sequence : :Sec Str :============================================ :BL:SWS|20->864,942->1544|APSA_EMENI|e-159|45.7|1373/1676