[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02965"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------111111111111111111111111111111111111111111111111-11-1------1------------11--1111-11111-1-11------12-11-1--11111--2-141111---111---------1--1----1--------1---------------------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEKQGDAPQLIREATELAQVLSAPGNASFVQTAQARLQTLQKSAAGWAIADSLLGSEDAN:Sequence : :Sec Str : ==================================================:RP:SCP|11->120|1wa5C|3e-06|12.8|109/937|a.118.1.1 : =================================:BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 61: . . . * . .: 120 :VRFYGALTLTMKIHQDWANLGEQMVRDLLIRLVDCFLLLVNKNETPVVMRKFITSMTAMF:Sequence : :Sec Str :============================================================:RP:SCP|11->120|1wa5C|3e-06|12.8|109/937|a.118.1.1 :============================================================:BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 121: . . + . . .: 180 :FKPQAPWTHCIRHVAISLANGKYLPEEQADLQSFQTLVLPSLNYDRLLAVMSFSTTLAEE:Sequence : :Sec Str :============================================================:BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 181: . * . . . .: 240 :SVRHAQNSSGYQDRLTANMNDAFFLINYSFQRAINNAQASANNVSSDQPTNTAQEAISSL:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|213->226|ainnaqasannvss :============================================================:BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 241: + . . . . *: 300 :QAWITAMRSVRVDRGALSSAVNVPISCAIRFLSEPRLAPNTMELLTDIILSQPKLLTPDH:Sequence : :Sec Str :============================================================:BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 301: . . . . + .: 360 :FTGIMDFLIGSDGEQYAMAILNGEFEDDQMRFLELLLRFASSETQIRVLTHSPDEKHERI:Sequence : H:Sec Str :============================================================:BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 361: . . . * . .: 420 :LFLLFKLFHAPGVGAVEDMASNLLLEFWTEAADNISELIMEGAFDEPTLSVKENFTRVIA:Sequence :HHHT TccccccHHHHHHHHHHHHHHTccc HHHHHHHHHHHHHTccc cHHHHHHH:Sec Str :============================================================:BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 421: . . + . . .: 480 :ECFDKFRYPNPSVLSEWEDDDVKIFNTFRRDFSDFLLATYPLLGVPMIQQIQERAAVAIR:Sequence :HHHHHHH HHHHHHHHcHHHHHHHHHHHHGGGccTTcTTTTHHHHHHH :Sec Str :============================================================:BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 481: . * . . . .: 540 :DHDWERFEVAMFCLASLADTIAENKHADDLLHALFHSELFDAICFGRTDIPLKTRQTLSD:Sequence : HHHHHHHHHHHH :Sec Str :======================================= :RP:SCP|481->519|1vzyA1|4e-04|10.3|39/233|d.193.1.1 :============================================================:BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 541: + . . . . *: 600 :MIAKYTPYFERNHNLLAPVLNFLFSSLGMPSSEQAAAKSISSLCGTCRQPLTIYVEEFIS:Sequence : :Sec Str :============================================================:BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 601: . . . . + .: 660 :KFAQLHANPSTNGHTLERVVEGIASVIQAVGSELGKANLLLKLLDPLCQEAKQARDISRT:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|634->647|lgkanlllklldpl :============================== :BL:SWS|28->630|KA111_SCHPO|6e-22|22.9|571/990 661: . . . * . .: 720 :GQHEAGLASGFRVMGCTASIGKGLRAPEEFCINLDEESPDRSAESDFWTGDPRATSLQSL:Sequence : :Sec Str 721: . . + . . .: 780 :IIQILEHLVNEFCADGDIIEGACDVLKAGYTEKSPGLTYLPLSDFHCYTSCRSFFSLIEA:Sequence : :Sec Str 781: . * . . . .: 840 :PQDKPEVVQAILHFTLVTLKGPDTLPLRAACSFWTTLLGLHDLPPAFTPDGLYKGQEQTA:Sequence : :Sec Str 841: + . . . . *: 900 :TAKPFDAYLAQLGDVVISQIAGKCARSELDHFSEVIKKFAFQHPGAAKMHLGNALVSLDA:Sequence : :Sec Str : ########### :PROS|884->894|PS00178|AA_TRNA_LIGASE_I|PDOC00161| 901: . . . . + .: 960 :SSNEAAGGPAGQPGNNHNADSGVSKSERARFLASIFAVRGSRATNNLVREFWVSCRGKGF:Sequence : :Sec Str : XXXXXXXXXXXXXXXXX :SEG|903->919|neaaggpagqpgnnhna 961: . . . * . .:1020 :AYA :Sequence : :Sec Str