[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02969"

            ""
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-------------------------------------------------------------------------------------------------------------- ------------------1-21-222111--------1111111-----1---------111-----------------------------1---------------------------------------------------------------------------------------------------7------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGYQQWVIVKITNSTNKALKIANLRLMYGKIHREGNKDEEISADDVDSTEIAPNATYTLC:Sequence : ==========================================================:BL:SWS|3->133|ASPH_ASPFU|1e-30|43.5|131/139 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->130|PF06355|1e-31|50.0|126/130|Aegerolysin 61: . . . * . .: 120 :TCGRSDSPSGAEGALQLMQEQAAVCTLYWDCPWGSKTNNFEVQDRNKQYVVSAEGWVREG:Sequence :============================================================:BL:SWS|3->133|ASPH_ASPFU|1e-30|43.5|131/139 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->130|PF06355|1e-31|50.0|126/130|Aegerolysin 121: . . + . . .: 180 :GALGTAEVEVFKKG :Sequence :============= :BL:SWS|3->133|ASPH_ASPFU|1e-30|43.5|131/139 :$$$$$$$$$$ :RP:PFM|4->130|PF06355|1e-31|50.0|126/130|Aegerolysin