[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_02986"

            ""
            ""

OrgPattern TTKANHFITSTRSPTJiHLKGNJUpNQdiQfOH8DBBAGEHCDSVNTmMQ*tZ7RcSSWNRLJDR188 TbtK*difrrtXZXXSUPO-OlCCY*PPPPQPtppru***N*U*s*ygwjeR**yKRhEEr*rn*l****feecc*fegO*jbDBABDRSPI6KCFM--EETKJIaJYMR67777779BBBBBBFSOIVbNJUTaReqq**KIH*TwlpweeoadTVSINLPLffXk***ZMQKNLLLQLNIJgTZKKpiAZaw*******************z****enu**nn***y*y**ZggefeedfegggfcWfZXX*qbi**jSkdrxwQQ**eWQajmhilttx*yt****w*xwtrv*swwdeedcefghgfcd*usnlltswln*v*********h*jp***Xfgc*mmww*jpTJ**ujTbhlRUofmjSZaXLeURRLJLIHKeP***YOr****************-ip*lc*j***RD**************IIL**********TSTTTTTTtUaKSgW*66666666776878BC8A987B87996A6HEDIBD***********vsrto********c********BK**mxippq*w****cmeKUKPfVEGGFHEGTPNWfcev*SgSqfUhqbZjIbcaUWYiQeTSOVxwW*OKKNEGGHHFG9AAAAAAAAHQDFJKInkuQpRWISItSWYZVNScVSSTSXacWbZ5-FLWJK222222*x**U*ww***x***uw-*wwx*x*x*z***uvvuuu*****pskqrlonqqqqqnoqoon*plprrrvQ5************33KHBECBCOOPOJH*i*bZXZZVIPSONROQcNPQOPFTGLSqaqsrqw***v**wtd***EFFEEGGEFHjpn*pqqqpz*zuxPQQJLKIIJMBBBB44NVPPIHHI77675778*BaCCBCF-CBD9DEDJLJCDODDBBBAXevWTi*jojBaN 789AtqS-xTDCbqdOSXMUYcZpYxVOOGJIJWYSKTRQRPOIIIbTXmfknpVSbRPOOPLFL8BB2IB7HEKDG2FIBIHFPM7A-bpGSXVVLJMNIDNYbO7Z***lte*v*WPROShP**Q*K**y1*d*TQTOtPX*nJaPQJnLI*Tgbd*a**Z*bgZ*ks*zu*gJUQL*KHISS*w**M**PO****r ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAGDPEKPSETAAQLAVQKTSNSSPGTGPSSASGSTVGDGDNLKKLDSKLANEKRESNLD:Sequence : XXXXXXXXXXXXXXXXX :SEG|20->36|tsnsspgtgpssasgst : ============:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 61: . . . * . .: 120 :DSLAHLPEHERDIIKQQLEIPETKVKFFTLYRYATTNDIIILLVSAVASIAGGAALPLFT:Sequence : XXXXXXXXXXXXXX :SEG|103->116|lvsavasiaggaal :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 121: . . + . . .: 180 :ILFGQMAGTFQRIILGTISYDEFNDTLSKYALYFVYLGIAEFVLIYTCTVGFIYTGEHIA:Sequence : ========================================:RP:SCP|141->409|2hydA2|3e-25|12.6|269/323|f.37.1.1 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->360|PF00664|4e-18|24.7|215/274|ABC_membrane 181: . * . . . .: 240 :QKIRERYLDAVLRQNIAFFDKLGAGEITTRITADTNLIQDGISEKVGLTLTALATFVTAF:Sequence : XXXXXXXXXXXXX:SEG|228->241|ltltalatfvtafv :============================================================:RP:SCP|141->409|2hydA2|3e-25|12.6|269/323|f.37.1.1 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->360|PF00664|4e-18|24.7|215/274|ABC_membrane 241: + . . . . *: 300 :VIGFIKYWKLTLICCSTVVAIVTIMGGASRFIIRFSKKNVESYGEGGTVAEEVLSSIRNA:Sequence :X :SEG|228->241|ltltalatfvtafv :============================================================:RP:SCP|141->409|2hydA2|3e-25|12.6|269/323|f.37.1.1 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->360|PF00664|4e-18|24.7|215/274|ABC_membrane 301: . . . . + .: 360 :TAFGTQEKLAKQYDAHLLEAQKWGTKLQMTIGIMVGGMMSIVFLNYGLGFWMGSRFIVSG:Sequence :============================================================:RP:SCP|141->409|2hydA2|3e-25|12.6|269/323|f.37.1.1 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->360|PF00664|4e-18|24.7|215/274|ABC_membrane 361: . . . * . .: 420 :ETELANIITILLAIIIGSFSLGNVTPNAQAFTSAIAAGAKIFSTIDRKSPIDPTSEDGET:Sequence :XXXXXXXXXXXXXXXX :SEG|361->376|etelaniitillaiii :================================================= :RP:SCP|141->409|2hydA2|3e-25|12.6|269/323|f.37.1.1 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 421: . . + . . .: 480 :LEKVEGNIEFRDIRHIYPSRPEVLVMKGVNLFVPAGKTTALVGPSGSGKSTVIGLLERFY:Sequence : ======================================================:RP:SCP|427->660|1e69A|3e-46|17.4|224/263|c.37.1.12 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 : $$$$$$$$$$$:RP:PFM|470->604|PF00005|2e-15|43.0|121/123|ABC_tran 481: . * . . . .: 540 :NPVGGSVLVDGVDIQNLNLKWLRQQISLVSQEPTLFGTTIYNNIKQGLIGSPFELEPDQS:Sequence :============================================================:RP:SCP|427->660|1e69A|3e-46|17.4|224/263|c.37.1.12 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|470->604|PF00005|2e-15|43.0|121/123|ABC_tran 541: + . . . . *: 600 :VRQRIENAAKMANAHDFIMGLPEKYETHVGERGFLLSGGQKQRIAIARAIVSDPKILLLD:Sequence : ############### :PROS|576->590|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|427->660|1e69A|3e-46|17.4|224/263|c.37.1.12 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|470->604|PF00005|2e-15|43.0|121/123|ABC_tran : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|575->643|PF02463|5e-05|37.7|69/536|SMC_N 601: . . . . + .: 660 :EATSALDTKSEGVVQAALDEASKGRTTIIIAHRLSTIKTADNIVVLVDGRIVEQGTHDEL:Sequence :============================================================:RP:SCP|427->660|1e69A|3e-46|17.4|224/263|c.37.1.12 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$ :RP:PFM|470->604|PF00005|2e-15|43.0|121/123|ABC_tran :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|575->643|PF02463|5e-05|37.7|69/536|SMC_N 661: . . . * . .: 720 :VERDGTYLRLVEAQRINEERDAQAMADSDDGEESPMGSDADALRLQKSITAASNASARFA:Sequence :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 721: . . + . . .: 780 :DEKMDLELQKTETKKSLSSVILSKREPEKDKEYGLGTLIKFISSFNAAEWKLMVTGLAVS:Sequence :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 781: . * . . . .: 840 :IICGAGQPTMAVFFSKCISALALPPPLYDKLRSDANFWCLMFLMLGIVMFFAYSIQGSLF:Sequence : =====================:RP:SCP|820->1079|2hydA2|2e-19|13.8|258/323|f.37.1.1 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|820->1034|PF00664|1e-14|26.5|213/274|ABC_membrane 841: + . . . . *: 900 :AYCSEKLIYRARSKAFRSMLRQDIAFFDVDENSTGALTSFLSTETKHLSGISGVTLGTIL:Sequence :============================================================:RP:SCP|820->1079|2hydA2|2e-19|13.8|258/323|f.37.1.1 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|820->1034|PF00664|1e-14|26.5|213/274|ABC_membrane 901: . . . . + .: 960 :MVTTTLAASMVVGLAIGWKLALVCISCVPVLLACGFYRFWILAAFQRRAKKAYEASASYA:Sequence : XXXXXXXXXXXX:SEG|949->966|akkayeasasyaceatsa :============================================================:RP:SCP|820->1079|2hydA2|2e-19|13.8|258/323|f.37.1.1 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|820->1034|PF00664|1e-14|26.5|213/274|ABC_membrane 961: . . . * . .:1020 :CEATSAIRTVASLTREPDVSGTYHGQLVVQGKKSLVSILKSSTLYAASQSFMFFVLALGF:Sequence :XXXXXX :SEG|949->966|akkayeasasyaceatsa :============================================================:RP:SCP|820->1079|2hydA2|2e-19|13.8|258/323|f.37.1.1 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|820->1034|PF00664|1e-14|26.5|213/274|ABC_membrane 1021: . . + . . .:1080 :WYGGTLLGKGEYTLFQFFLAFSEVIFGAQSAGTVFSFAPDMGKAKSAAADFKKLFDRRPP:Sequence :=========================================================== :RP:SCP|820->1079|2hydA2|2e-19|13.8|258/323|f.37.1.1 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$ :RP:PFM|820->1034|PF00664|1e-14|26.5|213/274|ABC_membrane 1081: . * . . . .:1140 :IDTLSKEGDDVEHIEGTIEFRDVHFRYPTRPEQPVLRGLNLSVKPGQYVALVGPSGCGKS:Sequence : ===========================================:RP:SCP|1098->1331|1b0uA|2e-45|24.5|231/258|c.37.1.12 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 : $:RP:PFM|1140->1267|PF00005|2e-14|35.0|114/123|ABC_tran 1141: + . . . . *:1200 :TTIALLERFYDTLSGGVYVDGTDITRWNVSAYRSFLALVSQEPTLYQGSIRDNILLGITE:Sequence :============================================================:RP:SCP|1098->1331|1b0uA|2e-45|24.5|231/258|c.37.1.12 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1140->1267|PF00005|2e-14|35.0|114/123|ABC_tran 1201: . . . . + .:1260 :DDVPEEAIIEACKAANIYDFIMSLPDGFSTLVGSKGSMLSGGQKQRIAIARALIRDPKIL:Sequence : ############### :PROS|1239->1253|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|1098->1331|1b0uA|2e-45|24.5|231/258|c.37.1.12 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1140->1267|PF00005|2e-14|35.0|114/123|ABC_tran 1261: . . . * . .:1320 :LLDEATSALDSESEKVVQVALDAAAKGRTTIAVAHRLSTIQKADVIYVFDQGRITESGTH:Sequence :============================================================:RP:SCP|1098->1331|1b0uA|2e-45|24.5|231/258|c.37.1.12 :============================================================:BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362 :$$$$$$$ :RP:PFM|1140->1267|PF00005|2e-14|35.0|114/123|ABC_tran 1321: . . + . . .:1380 :SELLAKKGRYYELVHMQSLGKTH :Sequence :=========== :RP:SCP|1098->1331|1b0uA|2e-45|24.5|231/258|c.37.1.12 :===================== :BL:SWS|49->1341|PMD1_SCHPO|0.0|47.4|1284/1362