[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_10403"

            ""
            ""

OrgPattern -------------------------------------------------------------------- 147-411111111123223-32111233333111111111132411222---111111--534161131111111111----512212-----111---1-3211213-1----------------1-------1-544331-13-73352224422111112343264541211111211-12311111--11111111-11111111-12211111-341-12------211--------------------1111111--111--11111121-11-------------------------------------------2-231333333332311----443-11-11--238843--3111112----12--113------266722-4444522212222222-121--5122-2--11-1-2---2211---2-12222112--------1----73--------------------------------131-1----211112232321131333323121224---44144-222151121-31--131-------1--43466321211-35112-32332221211-15733--------------------1----221112112-1-111111111111121111121--2313------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11---------123-11111111111111112222211---3222122333211113222---------11111111111111111111111111111--2-332244--------212--------------------------2-1-------1- 1-11-----------1-----------------------1-----------------1--------1-1--1---1--------------------------------1------------------------------------------------------1------4------1-4-1--1--------312-14 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDNDAPLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSD:Sequence : TccccccccccGGGGGGGGGcEEEEEcTTcEEEcTTcccccEEEEEEccEEEEEEcTT:Sec Str : =======================================================:RP:SCP|6->140|2h6bA2|6e-21|15.9|132/145|b.82.3.2 : ===========================:BL:SWS|34->210|CRP_HAEIN|3e-21|31.4|175/224 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|29->111|PF00027|2e-21|50.6|83/90|cNMP_binding 61: . . . * . .: 120 :GRENLLAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVARGL:Sequence :ccEEEEEEEcTTcEEcccccccccccEEEEEEcccEEEEEEcHHHHHHHHHHcTHHHHHH:Sec Str : XXXX:SEG|117->131|argllaqlagrlrka : ################## :PROS|75->92|PS00889|CNMP_BINDING_2|PDOC00691| :============================================================:RP:SCP|6->140|2h6bA2|6e-21|15.9|132/145|b.82.3.2 :============================================================:BL:SWS|34->210|CRP_HAEIN|3e-21|31.4|175/224 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|29->111|PF00027|2e-21|50.6|83/90|cNMP_binding 121: . . + . . .: 180 :LAQLAGRLRKANDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQL:Sequence :HHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHcEEETTEEEEcccccHHHHHHH:Sec Str :XXXXXXXXXXX :SEG|117->131|argllaqlagrlrka :==================== :RP:SCP|6->140|2h6bA2|6e-21|15.9|132/145|b.82.3.2 : ======================================:RP:SCP|143->221|2gauA1|3e-10|33.3|78/81|a.4.5.4 :============================================================:BL:SWS|34->210|CRP_HAEIN|3e-21|31.4|175/224 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|132->208|PF04492|4e-04|31.4|70/97|Phage_rep_O 181: . * . . . .: 240 :VGASRETVNKALADFASRGWLRLEPRSVVIMDIERMARRAR :Sequence :HTccHHHHHHHHHHHHHTTcEEEccccEEEccHHHHHHHHH :Sec Str :========================================= :RP:SCP|143->221|2gauA1|3e-10|33.3|78/81|a.4.5.4 :============================== :BL:SWS|34->210|CRP_HAEIN|3e-21|31.4|175/224 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|132->208|PF04492|4e-04|31.4|70/97|Phage_rep_O