[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE0434"

CPE0434     "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11----------------------------------------------------------------------------------------------------------------222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MESKENSKKSSEAKNKLEKIYSTSLPDGYRFTDFRIGDENNWAYIQYSAGVFKDYQLAIR:Sequence : cccEEEEcEEEEccGGGHHHHHHTTGGGccccHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|2->19|eskenskksseaknklek : ===========================:RP:SCP|34->160|2fiwA1|2e-09|21.2|118/156|d.108.1.1 61: . . . * . .: 120 :RIFKEENSLKGNFKNRCVFLENENGERIGTIMIVPSLSEEEGVQEIKYLALLPKYQEQGL:Sequence :HHTcTTccGGGEEEccEEEEEEETTEEEEEEEEEEEcTTccTTEEEEEEEEcGGGTTccH:Sec Str :============================================================:RP:SCP|34->160|2fiwA1|2e-09|21.2|118/156|d.108.1.1 : ===============:BL:SWS|106->161|MAK3_XENLA|1e-04|39.3|56/273 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|84->159|PF00583|4e-05|33.8|74/80|Acetyltransf_1 121: . . + . . .: 180 :GKLLISKAYKMVDDVEGATRINLEAYNDKSIVLFENLGFERS :Sequence :HHHHHHHHHHHHHHcTTccEEEEEETEGGGHHHHHHTTcEEc :Sec Str :======================================== :RP:SCP|34->160|2fiwA1|2e-09|21.2|118/156|d.108.1.1 :========================================= :BL:SWS|106->161|MAK3_XENLA|1e-04|39.3|56/273 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|84->159|PF00583|4e-05|33.8|74/80|Acetyltransf_1