[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE0797"

CPE0797     "conserved hypothetical protein"
            ""

OrgPattern --------1---11---------------------11---------------1--------------- --------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------1-11111212422221121-1121422-------------1----------------------------------------------------------------------------------------------21222--111-11----111------------------21111------------1---------------------------------------------------------------------------------------------------------------------------1--1-1-111111----1--111-------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------1-------1--------------1-11111111111111----------1--------------------------------------------1-1111------------------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNFWNDIFNSINGLAGKNHLLDSIMLFSSKRLPYILFATVIVVYLIGIISKNKKARGIAV:Sequence : HHHHHHHHHHHHTT TTcHHHHHHHHHTccccHHHHHHHHHHHHTccccTTTcHHHHHH:Sec Str :============================================================:BL:SWS|1->193|YWOA_BACSU|1e-23|32.3|186/193 61: . . . * . .: 120 :DTIVFTGINLILAVIVGHFFYAPRPFVNDPNAKLLYPHKPDSSFPSGHSVGSMSIALGLN:Sequence :HHHHHHHHHTTTTHHHHHHHccccHHHHHTccGGHHHHHTccccccHHHHHHHHHHHHHH:Sec Str : ===================:RP:SCP|102->193|1ayrA1|3e-10|14.9|87/182|b.1.18.11 :============================================================:BL:SWS|1->193|YWOA_BACSU|1e-23|32.3|186/193 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|71->165|PF01569|7e-08|41.8|91/132|PAP2 121: . . + . . .: 180 :RYNKALGTICVILSILMGISRVYVGHHYPQHVVASFLIVIILNVLYMKFLSKSVQKLYFS:Sequence :HHcGGGHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|102->193|1ayrA1|3e-10|14.9|87/182|b.1.18.11 :============================================================:BL:SWS|1->193|YWOA_BACSU|1e-23|32.3|186/193 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|71->165|PF01569|7e-08|41.8|91/132|PAP2 181: . * . . . .: 240 :IEKHIPILNKLVK :Sequence :HTcTTTcc :Sec Str :============= :RP:SCP|102->193|1ayrA1|3e-10|14.9|87/182|b.1.18.11 :============= :BL:SWS|1->193|YWOA_BACSU|1e-23|32.3|186/193