[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAB80503.1 cper0 CPE0797 "conserved hypothetical protein"
MNFWNDIFNSINGLAGKNHLLDSIMLFSSKRLPYILFATVIVVYLIGIISKNKKARGIAV
DTIVFTGINLILAVIVGHFFYAPRPFVNDPNAKLLYPHKPDSSFPSGHSVGSMSIALGLN
RYNKALGTICVILSILMGISRVYVGHHYPQHVVASFLIVIILNVLYMKFLSKSVQKLYFS
IEKHIPILNKLVK
//