[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE0845"

CPE0845     "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKRKLIALSLSISILSGTFFTLPIDKNVYANDLKNEGKYQDEIVLLDEEIYLDKEQLELF:Sequence : XXXXXXXXXXXX :SEG|5->16|lialslsisils : ================================:BL:SWS|29->158|DYHC_NEUCR|2e-04|23.1|117/4367 61: . . . * . .: 120 :KQNALVEEKNSLGRSFSSDYNTYVQKSVSKSEAIQIISAYDKVTGMIDNLGFTIGGSTLV:Sequence :============================================================:BL:SWS|29->158|DYHC_NEUCR|2e-04|23.1|117/4367 121: . . + . . .: 180 :ASISKSSRYRNAKNFITKYGSWGGNIILVTSFVAYKSIGKFKGEVQNAVYKMNSYDKLLF:Sequence :====================================== :BL:SWS|29->158|DYHC_NEUCR|2e-04|23.1|117/4367 181: . * . . . .: 240 :RVESATNLQDSGMCRYKLVVQKR :Sequence