[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cper0:CPE0876"

CPE0876     "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------1--------------------------------------11---111-----111121211111---11111------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSNIYEFKKEDLNECAELFVKTFSKEPWNEPWDFENAKKRLNDVVLTPGFRGAVLRNDEK:Sequence :TEEEEEccGGGHHHHHHHHHHHHHHTGGGccccHHHHHHHHHcHHHHcccccEEEEEEcc:Sec Str : =========================================================:RP:SCP|4->146|1yk3A1|1e-12|14.7|143/198|d.108.1.1 61: . . . * . .: 120 :IEGVILGNLEQWYDGEHFCVKEFFVDSSSQGKGTGKKLLNALEDILMEKEVGVIHFWTMK:Sequence :EEEEEEEEEEEETTTEEEEEEEEEEEGGGTTccHHHHHHHHHHHHHHHTTcccEEEcccT:Sec Str :============================================================:RP:SCP|4->146|1yk3A1|1e-12|14.7|143/198|d.108.1.1 : =========================================:BL:SWS|80->139|TTR_PSESZ|7e-07|35.0|60/177 121: . . + . . .: 180 :GSTAEAFYNKRGYEIPKELIMMRKKLK :Sequence :TcHHHHHHHHHTcccEEEEEEEEEEcc :Sec Str :========================== :RP:SCP|4->146|1yk3A1|1e-12|14.7|143/198|d.108.1.1 :=================== :BL:SWS|80->139|TTR_PSESZ|7e-07|35.0|60/177